Examples of Comparative Biology

Diagrams for the peptide NAD4 from several species are shown here.
It is unclear for the present as to whether these diagrams should be identical to each other.

Examples of non-synonymous mutations are:
A10895G - giving 'N46D'  (defines Haplogroup B2a1 etc.)
A10899G - giving 'N47S'  (defines Haplogroup L3d3a etc.)
T10907C - giving 'F50L'  (defines Haplogroup U4c etc.)
G11778A - giving 'R340H' (LHON)
T11204C - giving 'F149L' (defines Haplogroup U6a2a etc.)

NAD4  Mammal - Human NC_012920
Enlarge

Chimp NAD4  Mammal - Chimpanzee NC_001643
Enlarge

Cattle NAD4  Mammal - Cattle NC_006853
Enlarge

Wallaroo NAD4  Marsupial - Wallaroo NC_001794
Enlarge

Zebrafish NAD4  Fish - Zebrafish NC_002333
Enlarge

Chinese Egret NAD4  Bird - Chinese Egret NC_009736
Enlarge

Chinese Toad NAD4  Amphibia - Chinese Toad NC_006403
Enlarge

Sea Lamprey NAD4  Lamprey - Sea Lamprey NC_001626
Enlarge

Liver Fluke NAD4  Platyhelminthes - Liver Fluke NC_002546
Enlarge

Snail NAD4  Mollusca - Snail NC_010220
Enlarge

Honey Bee NAD4  Insect - Honey Bee NC_001566
Enlarge

Russian Grayling NAD4  Insect - Russian Grayling NC_014587
Enlarge

Bryozoan NAD4  Bryozoan NC_008192
Enlarge

Amino acid sequences for peptide NAD4:- CRS 10760-12136

                              1         2         3         4         5         6         7         8         9       100         1         2         3         4         5         6         7         8         9       200         1         2         3         4         5         6         7                8         9       300         1         2         3         4         5         6         7         8         9       400         1         2         3         4         5         
Mammals:
Human              - MLKLIVPTIMLLPLTWLSKKHMIWINTTTHSLIISIIPLLFFNQINNNLFSCSPTFSSDPLTTPLLMLTTWLLPLTIMASQRHLSSEPLSRKKLYLSMLISLQISLIMTFTATELIMFYIFFETTLIPTLAIITRWGNQPERLNAGTYFLFYTLVGSLPLLIALIYTHNTLGSLNILLLTLTAQELSNSWANNLMWLAYTMAFMVKMPLYGLHLWLPKAHVEAPIAGSMVLAAVLLKLGGYGMMRLTLILNPLTKHMAYPFLVLSLWGMIMTSSI       CLRQTDLKSLIAYSSISHMALVVTAILIQTPWSFTGAVILMIAHGLTSSLLFCLANSNYERTHSRIMILSQGLQTLLPLMAFWWLLASLANLALPPTINLLGELSVLVTTFSWSNITLLLTGLNMLVTALYSLYMFTTTQWGSLTHHINNMKPSFTRENTLMFMHLSPILLLSLNPDIITGFSS   - Human
Human variations   -      I          F  NQ     A       N         FDS  L Y L   P                   VV     FN  P    F      F  V  V ALS         L       S V      S S        L               TH   I                P     S       T               L            M T              M   K                  M                           V       A             I                          H         A                                    A  S           I T    H        P AY  SS          F     F  F         I  PY 

KF683087(Heidel)   - MLKLIVPTIMLLPLTWLSKKHMIWINTTTHSLIISIIPLLFFNQINSNLFSCSPTFSSDPLTTPLLMLXTWLLPLTIMASQRHLSNEPLSRKKLYLSMLISLQISLIMTFTATELIMFYIFFETTLIPTLAIITRWGNQPERLNAGTYFLFYTLVGSLPLLIALTYTHNTXGSLNILLLTLTAQELSNSWANNLMWLAYTMAFMVKMPLYGLHLWLPKAHVEAPIAGSMVLAAVLLKLGGYGMMRLTLILNPLTKHMAYPFLVLSLWGMIMTSSI       CLRQTDLKSLIAYSSISHMALVVTAILIQTPWSFTGAVILMIAHGLTSSLLFCLANSNYERTHSRIMILSQGLQTLLPLMAFWWLLASLANLALPPTINLLGELSVLVTTFSWSNITLLLTGLNMLVTALYSLYMFTTTQWGSLTHHINNMKPSFTRENTLMFMHLSPILLLSLNPDIITGFSS
KC879692(Denisova) - MLKLIVPTIMLLPLTWLSKKHMIWINTTTHSLIISIIPLLFFNQINNNLFSCSPTFSSDPLTTPLLMLTTWLLPLTIMASQRHLSSEPLSRKKLYLSMLISLQISLIMTFTATELIMFYIFFETTLIPTLAIITRWGNQPERLNAGTYFLFYTLVGSLPLLIALIYTHNTLGSLNILLLTLTAQELSNSWANNLMWLAYTMAFMVKMPLYGLHLWLPKAHVEAPIAGSMVLAAVLLKLGGYGMMRLTLILNPLTKHMAYPFLVLSLWGMIMTSSI       CLRQTDLKSLIAYSSISHMALVVTAILIQTPWSFTGAVILMIAHGLTSSLLFCLANSNYERTHSRIMILSQGLQTLLPLMAFWWLLASLANLALPPTINLLGELSVLVTTFSWSNITLLLTGLNMLVTALYSLYMFTTTQWGSLTHHINNMKPSFTRENTLMFMHLSPILLLSLNPDIITGFSS

Chimp              - MLKLIIPTIMLLPLTWFSKKRMIWINTTTHSLIISTIPLLFFNQINNNLFSCSLPFSSDPLTTPLLMLTAWLLPLTIMASQRHLSNEPLSRKKLYLSMLISLQISLIMTFSATELIMFYIFFETTLIPTLAIITRWGNQPERLNAGTYFLFYTLVGSLPLLIALIYTHNTLGSLNILLLTLTTQELSNTWANNLMWLAYTMAFMVKMPLYGLHLWLPKAHVEAPIAGSMVLAAVLLKLGGYGMMRLTLILNPLTKHMAYPFLMLSLWGMIMTSSI       CLRQTDLKSLIAYPSVSHMALVVTAILIQTPWSFTGAIILMIAHGLTSSLLSCLANSNYERTHSRIMILSQGLQTLLPLMAFWWLLASLANLALPPTINLLGELSVLVTSFSWSNTTLLLTGFNMLITALYSLYMFTTTQWGSLTHHINSMKPSFTRENTLMFLHLSPILLLSLNPDIITGFTS   - Chimp NC_001643
Pygmy chimpanzee   - MLKLIIPTIMLLPLTWFSKKRMIWINTTTHSLIISTIPLLFFNQINNNLFSCSLSFSSDPLTTPLLMLTAWLLPLTIMASQRHLSNEPPSRKKLYLSMLISLQISLIMTFSATELIMFYIFFETTLIPTLAIITRWGNQPERLNAGTYFLFYTLVGSLPLLIALIYTHNTLGSLNILLLTLTAQELSNTWANNLMWLAYTMAFMVKMPLYGLHLWLPKAHVEAPIAGSMVLAAVLLKLGGYGMMRLTLILNPLTMHMAYPFLMLSLWGMIMTSSI       CLRQTDLKSLIAYSSVSHMALVVTAILIQTPWSFTGAVILMIAHGLTSSLLFCLANSNYERTHSRIMILSQGLQTLLPLMAFWWLLASLANLALPPTINLLGELSVLVTSFSWSNTTLLLTGFNMLITALYSLYMFTTTQWGPLTHHINNMKPSFTRENTLMFMHLSPILLLSLNPDIITGFTS   - Pygmy chimpanzee JF727231
Pygmy chimpanzee   - MLKLIIPTIMLLPLTWFSKKRMIWINTTTHSLIISTIPLLFFNQINNNLFSCSLSFSSDPLTTPLLMLTAWLLPLTIMASQRHLSNEPPSRKKLYLSMLISLQISLIMTFSATELIMFYIFFETTLIPTLAIITRWGNQPERLNAGTYFLFYTLVGSLPLLIALIYTHNTLGSLNILLLTLTAQELSNTWANNLMWLAYTMAFMVKMPLYGLHLWLPKAHVEAPIAGSMVLAAVLLKLGGYGMMRLTLILNPLTMHMAYPFLMLSLWGMIMTSSI       CLRQTDLKSLIAYSSVSHMALVVTAILIQTPWSFTGAVILMIAHGLTSSLLFCLANSNYERTHSRIMILSQGLQTLLPLMAFWWLLASLANLALPPTINLLGELSVLVTSFSWSNTTLLLTGFNMLITALYSLYMFTTTQWGPLTHHINNMKPSFTRENTLMFMHLSPILLLSLNPDIITGFTS   - Pygmy chimpanzee JF727227
Gorilla            - MLKLIAPTIMLLPLTWLSKKHMIWINTTTHSLIISIIPLLFFNQINNNLFSYSLSFSSDPLTTPLLMLTTWLLPLTIMASQRHLSNEPLSRKKLYLSMLISLQISLIMTFTATELIMFYIFFEATLIPTLVIITRWGNQPERLNAGTYFLFYTLVGSLPLLIALIHTHNTLGSLNILLLTLTAQELPNSWANNLMWLAYTMAFMVKMPLYGLHLWLPKAHVEAPIAGSMMLAAVLLKLGGYGMMRLMLILNPLTKHMAYPFLALSLWGMIMTSSI       SLRQTDLKSLIAYSSISHMALVVAAILIQTPWSFTGAVVLMIAHGLTSSLLFCLANSNYERTHSRIMILSQGLQTLLPLMALWWLLASLANLALPPTINLLGELSVLVTTFSWSNTTLLLTGSNMLITALYSLYMFTTTQWGPLTHHITNMKPSFTRENILMFMHLSPILLLSLNPDIITGFTS   - Gorilla
Chacma Baboon      - MLKMVIPTTMLLPTTWLSKSNTIWINLTAHSLTISLIPLLFFNQTDNNLLSYSTHLSSDPLATPLLTLTAWLLPLMIMASQYHLHNKPPSQKKLYLSMMIFLQITLILTFMATELIMFYILFETTLIPTLIIITKWGNQAERLNAGSYFLFYTLTGSLPLLIMLIYTYNKTGSLNITLLTLTDQKLTTTWSHNLTWLACMMAFMTKLPLYGLHLWLPKAHVEAPIAGSMVLAAVLLKLGGYGMMRLTSILNPLTEYMAYPFLMLSLWGMIMTSST       CLRQTDLKSLIAYSSVSHMALVIVASLIQTPWSFSGATILMIAHGLTSSMYFCLANSNYERTHSRIMLLSRGLQILLPLMTFWWLMTSLTNLALPPTINLIGELFVIAASFSWSKITIILTGLNMLITALYSLHMFTTMQRGALTHHTINMKPPFTRENTLMFLHLAPTILLSLNPNTIPGPTP   - Chacma Baboon NC_020010
Olive Baboon       - MLKMVIPTTMLLPTTWLSKDSTIWINLTTHSLTISLIPLLFFNQTDNNLLSHSIHLSSDPLTTPLLTLTAWLLPLMIMASQYHLHNEPPSQKKLYLSMMIFLQITLILTFMATELIMFYILFETTLIPTLIIITKWGNQAERLNAGSYFLFYTLTGSLPLLIMLIYTYNKTGSLNTTLLTLTDQKLTTTWSHNLTWLACMMAFMTKLPLYGLHLWLPKAHVEAPIAGSMVLAAVLLKLGGYGMMRFTSILNPLTEYMAYPFLMLSLWGMIMTSST       CLRQTDLKSLIAYSSVSHMALVIVASLIQTPWSFSGATILMVAHGLTSSMYFCLANSNYERTHSRIMLLSRGLQILLPLMTFWWFMASLTNLALPPTINLIGELFVIAASFSWSKITMILTGLNMLITALYSLHMFTTMQRGALTHHMTNMKPPFTRENTLMFLHLAPTILLSLNPNTILGLTP   - Olive Baboon JX946196.2
Olive Baboon       - MLKMVIPTTMLLPTTWLSKGNTIWINLTTHSLTISLIPLLFFNQTDSNLLSYSTHLSSDPLTTPLLTLTAWLLPLMIMASQYHLHNEPPSQKKLYLSMMIFLQITLILTFMATELIMFYILFETTLIPTLIIITKWGNQAERLNAGSYFLFYTLTGSLPLLIMLIYTYNKTGSLNTALLTLTDQKLTTTWSHNLTWLACMMAFMTKLPLYGLHLWLPKAHVEAPIAGSMVLAAVLLKLGGYGMMRLTSILNPLTEHMAYPFLMLSLWGMVMTSST       CLRQTDLKSLIAYSSVSHMALVIVASLIQTPWSFSGATILMIAHGLTSSMYFCLANSNYERTHSRIMLLSRGLQILFPLMTFWWFTASLTNLALPPTINLIGELFVIAASFSWSKITMILTGFNMLITALYSLHMFTTMQRGTLTHHTINMKPPFTRENTLMFLHLAPTILLALNPNTILGLTP   - Olive Baboon JX946197.2
Olvie Baboon       - MLKMVIPTTMLLPTTWLSKSNTIWINLTAHSLTISLIPLLFFNQTDNNLLSHSTHLSSDPLTTPLLTLTAWLLPLMIMASQHHLHNEPSSQKKLYLSMMIFLQITLILTFMATELIMFYILFETTLIPTLIIITKWGNQAERLNAGSYFLFYTLTGSLPLLIMLIYTYNKTGSLNTTLLTLTDQKLTTTWSHNLTWLACMMAFMTKLPLYGLHLWLPKAHVEAPIAGSMVLAAVLLKLGGYGMMRLTSILNPLTEYMAYPFLMLSLWGMVMTSLT       CLRQTDLKSLIAYSSVSHMALVIVASLIQTPWSFSGATILMIAHGLTSSMYFCLANSNYERTHSRIMLLSRGLQILLPLMTFWWFMASLTNLALPPTINLIGELFVIAASFSWSKITMILTGLNMLITALYSLHMFTTMQRGALTHHTINMKPPFTRENTLMFLHLAPTILLALNPNTILGLTP   - Olive Baboon JX946198
Cattle             - MLKYIIPTIMLMPLTWLSKNNMIWVNSTAHSLLISFTSLLLMNQFGDNSLNFSLLFFSDSLSTPLLILTMWLLPLMLMASQHHLSKENLTRKKLFITMLISLQLFLIMTFTAMELILFYILFEATLVPTLIIITRWGNQTERLNAGLYFLFYTLAGSLPLLVALIYIQNTVGSLNFLMLQYWVQPVHNSWSNVFMWLACMMAFMVKMPLYGLHLWLPKAHVEAPIAGSMVLAAVLLKLGGYGMLRITLILNPMTDFMAYPFIMLSLWGMIMTSSI       CLRQTDLKSLIAYSSVSHMALVIVAILIQTPWSYMGATALMIAHGLTSSMLFCLANSNYERIHSRTMILARGLQTLLPLMATWWLLASLTNLALPPTINLIGELFVVMSTFSWSNITIILMGVNMVITALYSLYMLIMTQRGKYTYHINNISPSFTRENALMSLHILPLLLLTLNPKIILGPLY   - Cow
African Elephant   - MLKTILPTIMLIPLAWFTSNNMVWINTTLYSFAISLTSLHLLYQPLDNSLNLSPEFFLDSLSTPLLILTIWLLPLMLIASQSHLSSGSTFQKKSYITTIILLQVSLIMTFAATDLILLYIMFETTLIPTMVIITRWGNQLERLNAGSYFLFYTLMGSLPLLVTLMLIQNTLGSLNLMMLPYLIKPIDNLWSTNMLWLTCTMAFMVKMPLYGLHLWLPKAHVEAPIAGSMVLAAILLKLGGYGMLRITILLDPLTTHMYYPFLMLSLWGMVMSSSI       CLRQTDMKSLIAYSSVSHMALVIIAIMLQTPWSFMGALTLMIAHGLTSSMLFCLANSNYERIHNRTMILARGLQTLLPLMATWWLLASLINMAPPPTINLIGELLIITTSFSWSNLTIFPMGLNVLITTMYTLHMMTTTQRGKTSHHAKSIKPSFTRENTLMALHFLPLLLLSLNPKIILGLTY   - African Elephant NC_000934

Bowhead Whale      - MLKFIIPTIMLMPLTWLSKNNLIWINSTTHSLLISFTSLLLLNQLNDNSLNYSLIFFSDPLSTPLLMLTMWLLPLMLMASQSHLLKEPPVRKKLYITMLIMLQALLIMTFTATELILFYIMFEATLIPTLIIITRWGNQTERLNAGLYFLFYTLVGSLPLLVALTYLQNTTGSLNFLLLQHWAQPLSTSWSNIFLWLACMMAFLVKMPLYGLHLWLPKAHVEAPIAGSMVLAAVLLKLGGYGMLRITSMLNPLTEHMAYPFLMLSLWGMIMTSSI       CLRQTDLKSLIAYSSVSHMALVIAAILIQTPWSYMGATALMIAHGLTSSMLFCLANSNYERIHSRTMILARGLQIFLPLMATWWLLASLTNLALPPSINLIGELFVVVSAFSWSNPTILLMGTNIVITALYSLYMLIMTQRGKHTHHINNITPSFTREHTLMALHIIPLLLLSLNPKIILGPLY   - Bowhead Whale
Killer Whale       - MLKFIIPTVMLMPLTWLSKSNFIWINTTAHSLLISFTSLLLLNQFNDNSLNYSLTFFSDPLSAPLLMLTMWLLPLMLMASQSHLLKEPLARKKLYITMLVTLQTLLIMTFTAMELIMFYITFEATLIPTLILITRWGNQTERLNAGLYFLFYTLMGSLPLLVALTYLQNTVGSLNFLLLQYWTQPLSTSWSNTFMWLACMMAFLVKMPLYGLHLWLPKAHVEAPIAGSMVLAAVLLKLGGYGMLRITSILNPLTEHMAYPFLVLSLWGMIMTSSI       CLRQTDLKSLIAYSSISHMALIIAAVLIQTPWSYMGATALMIAHGLTSSMLFCLANSNYERTHSRTMILARGLQIFFPLMTTWWLLACLTNLALPPTINLIGELLVIMSTFSWSNLTIILMGVNIVITALYSLHMLIMTQRGKHTHHINNLTPTFTREHALMALHIIPLLLLSLNPKIILGPLY   - Killer Whale
Egyptian Rousette  - MLKIIIPTTMLIPLVWLSKNSMIWINTTAYSLMITLIGLPLLNQFNDNSLNMSLTYFSDSLSTPLLMLTMWLLPLMIIASQFHLIKESYTRKKLYITMLILLQIFLIMTFSATELILFYILFEATLVPTLIIITRWGGQTERLNAGLYFLFYTLVGSLPLLVALIYLQNILGSLNILLIQHWSSPLTNSWSNSLLWLACMMAFMVKMPLYGLHLWLPKAHVEAPIAGSMVLAAVLLKLGGYGMLRITTLLNPTTNFMAYPFLMLSLWGMIMTSSI       CLRQTDLKSLIAYSSVSHMALVIVAVLIQTPWSYMGATALMIAHGLTSSMLFCLANTNYERIHSRTMILARGLQTVLPLMAAWWLLASLTNLALPPSINLIGELFVVMSTFSWSPLSIGLMGINIIITALYSLYMLIMTQRGKQTHHISNLTPSYTRENTLMAMHILPLLLLSINPKIILGTLY   - Egyptian Rousette
European Hedgehog  - MLKVIMSTIMLIPLTWLSKSKHLWINTTLYSFLIALTSLMYLNKQYYMWTSSSITYFSDHISTPLLILTTWLLPLMIIASQYHLQKENLNQKKFYISMLIFLQILLIMTFTASEMFLFYILFEATLIPTLVIITRWGNQIERLNAGSYFLFYTLTGSLPLLVALLYLKKMNYSTHFVFMSLISDHYTMDWSNSLLWLSCMMAFMVKMPLYGIHLWLPKAHVEAPIAGSMILAAILLKLGGYGMMRINMLTAPITSTMYYPFIILSLWGMIMTSCI       CLRQTDLKSLIAYSSVSHMALVIAAIMIQTPLSYMGATTLMIAHGLTSSLMFCLANTNYERTHSRTMFLTRGLLIILPLMATWWLIASLNNLALPPTINLIGELFILMSLYSWSKFTIILTGLNMMITVSYTLYMLIITQRGLPSHHIISIKPSFTRENLLMTLHIIPLVLLIIKPHIILGNTL   - European Hedgehog
Giant Panda        - MLKIILPTMMLVPLTWMSKPNMIWINTTTYSLLISLISLTYLNQLSDNSLNFSLTFFTDSLSAPLLVLTTWLLPLMLMASQFHLSKETLTRKKLYITMLILLQLFLIMTFSATELIMFYILFEATLVPTLVIITRWGNQTERLNAGLYFLFYTLVGSLPLLVALLYAQNSLGSLNFLMVQYWTQPLPNSWSNIFMWLACMMAFMVKMPLYGLHLWLPKAHVEAPIAGSMVLAAVLLKLGGYGMMRITTMLNPLTNFMAYPFMMLSLWGMIMTSSI       CLRQTDLKSLIAYSSVSHMALVIVAILIQSPWSYMGATALMIAHGLTSSMLFCLANSNYERTHSRTMILARGLQTLLPLMAAWWLLAGLTNLALPPTINLIGELFVVMATFSWSNITILLMGVNITITALYSLYMLISTQRGKYTDHIKNIKPSYTRENALMALHLLPLLLLSLNPKVVLGFIY   - Giant Panda
Wallaroo           - MLKILVPTIMLIPLTWYSKKQWVWINPTAHSFLISIASLTLLYHSTDLGYSYSSSFYMDSLSGPLLVLSCWLLPLMMIASQNHLMKEPLNRKKTFLTTLIILQTSLIMAFSSSELIMFYIMFEATLIPTLIIITRWGNQNERLNAGLYFLFYTLTGSLPLLVALLYLHSKIGTLHILTLIMNPKPMELSMPNSILWYACTVAFMVKMPMYGLHLWLPKAHVEAPIAGSMVLAAILLKLGGYGIMRITILTQPITAHVYYPFIVLSLWGMIMTSSI       CLRQTDLKSLIAYSSVSHMGLVIVAALMQSTLSFMGATALMIAHGLTSSMLFCLANTNYERIHSRTMILARGLQLILPLMCTWWLLASLANLALPPTINLLGELAVIISSFSWSHFSIILLGANTVITALYSLHMLITSQRGKFTHHLYPMKPSFTREHILMMLHMIPLLIISMNPKFILGITY   - Wallaroo
Koala              - MLKILMPTFMLIPLTWLSKNLWLWTNLTSYSLLIGTFSITLLHQDSDLGTNHNNLFYTDSLSSPLLVLSCWLLPLMMMASQNHLNKESMNRKKAYLTTLIILQLSLITALSASELMMFYIMFETTLIPTLIIITRWGNQNERLNAGLYLLFYTLTGSIPLLIALLFLYNKLGSLHILAMTIMSTTLKPSYSNSILWYACMTAFMVKMPLYGLHLWLPKAHVEAPIAGSMVLAAILLKLGGYGIMRMTVFTQPLTTNLYYPFIILSLWGMVMTSFI       CLRQTDLKSLIAYSSISHMALVIIATLMQSPLSFMGATALMIAHGLTSSMLFGLANTNYERINSRTMILARGLQTILPLTCTWWILATLANLALPPTINFLCELLVITSSFSWSNFSIILLGINTIITALYSLHMLTTTQRGKPTYHTQTIKPTSTREHTLMILHLIPLLTISLSPKFILGLTY   - Koala
Australian Echidna - MLKILLPTVMLLPLISFSKKEWMWINSSAYSILISSLSLLTLNQHMDLGLNFNLNFFTDPLSSPLLVLSCWLLPLMILASQFHLMNESTTHKRMYLILLVSLQVALLMAFSAVEFMMYYILFETTLIPTLIIIARWGNQTERLNAGLYFLFYTLLGSLPLLVALIFTQAQMGSLHILLLTLTPNPLLNSWSNDILWLACMMAFLVKMPLYGFHLWLPKAHVEAPIAGSMVLAAILLKLGGYGILRIIIILEPISKLMAYPFIILATWGMIMTSSI       CLRQTDLKSLIAYSSVSHMGLVVAASLIQTPWGFMGATAMMIAHGLTSTMLFRLANTNYERAHSRTMVLIRGLQMVLPLMSSWWLLASLANLGLPPTINLISELMIIVSAFSWSNLTLILLGLNTVITAIYSLYMLTSVQRGKMTTHSLSINPTFTREHMIMALHLLPLILLTLNPKLILGVAY   - Australian Echidna

Non-mammals:
Zebrafish          - MLKVLIPTIMLFPTIWLSSSKWLWTTTTMNSFLIAFISLTWLKWTSDTGWNASNSYMAADPLSTPLLVLTCWLLPLMILASQNHINSEPVNRQRMYITLLASLQTFMIMAFGATKIIMFYIMFEATLIPTLIIITRWGNQAERLNAGTYFLFYTLAGSLPLLVALLLLQQSTGTLSMLVLQYSDPLLLNSWGHKIWWAGCLIAFLVKMPLYGMHLWLPKAHVEAPVAGSMILAAVLLKLGGYGMMRMMVMLDPLSKQLAYPFIILALWGVIMTGLV      CLRQTDLKSLIAYSSVGHMGLVAGGILIQTPWGFTGAIILMIAHGLTSSALFCLANTSYERTHSRTMILARGLQMVLPLATVWWFIANLANLALPPLPNLMGELMIITALFNWSPWTIIITGMGTLITANYSLYMFLTSQRGSIPEHITNLSPSHTREHLLMTLHLIPIILLMLKPELMWGWCN   - Zebrafish
threadfin cichlid  - MLKILLPTIMLVPTIWAIPAKHLWSTALSYSLIISLTSLVWLKSSAESGWSFLSPYMATDPLSTPLLALTCWLLPLMILASQNHTTSEPFSRQRTYITLLTSLQIFLIMAFSATEVIMFYIMFEATLIPTLVIITRWGNQTERLNAGTYFLFYTLAGSLPLLVALLLLQNSTGTLSLLTLQYAPSLQLSSFADKLWWAGCLLAFLVKMPLYGAHLWLPKAHVEAPIAGSMVLAAVLLKLGGYGMMRMMIMLEPLTKELSYPFIIFALWGVIMTGSI      CLRQTDLKSLIAYSSVSHMGLVAAGILIQTPWGFTGALILMIAHGLTSSALFCLANTNYERTHSRTMVLARGLQMVLPLMTAWWFIASLANLALPPLPNLMGELMIITSLFHWSWWTIALTGAGTLITASYSLYMFLMTQRGPLPAHIISLDPTHSREHLLLALHLLPLILLISKPELIWGWTA   - threadfin cichlid HE961974
Chinese Egret      - MLKIILPTIMLLPTTLLSPQKFLWTNTTTHSLLIATLSLQWLSPTYYPLKNTTQWTGIDQISSPLLVLSCWLLPLMILAGQNHLQHEPSPRKRIFITTLVMVQPFIILAFSTTELMLFYISFEATLIPTLVLITRWGNQPERLSAGTYLLFYTLISSLPLLITILFLHTQTGTLHLTMLKLTHPTLTTSWTNLLSGLALLMAFMVKAPLYGLHLWLPKAHVEAPIAGSMLLAALLLKLGGYGIMRITLLTNPLSNHLHYPFIALALWGALMTSSI       CLRQTDLKSLIAYSSVSHMGLVIAASLIQTHWSFSGAMILMTSHGLTSSMLFCLANTNYERTHSRILLLTRGLQPLLPLMATWWLLANLTNMALPPTTNLMAELTIMIALFNWSTPTIILTGIATLPSASYTLFMMLTTQRGILPNHITSIQNSNTREHLLMALHTIPMLLLILKPEIISGLPS   - Chinese Egret
Chinese toad       - MLVISTSLSILLLSTWLTPAKRLWEVITAQSLIIAIASMVWFCIQNNVTFLNSYFIIDQISSPLLILTCWLTAPTLLASQSKLSKEPISRQRAYIFTIIVLQITTLLAFLADNMLLFFILFESTMIPTLIIITRWGAQKERMLAGTYLLFYTLFGSMALLTALLFFHETFGTLSISLIKESSKELHPSACMLAWWTACFTAFLVKMPLYGVHLWLPKAHVEAPIAGSMILAGTLLKLGGYGILRINAIINDSFLQTAAPLIIFSMFGVLLSAAL        CSRQTDLKSLIAFSSVSHMGLVIAASLLKTDWSIAGSLILMISHGLVSSALFCLANTSYERTHTRTLVVLQGSQIILPLSAAWWLMAALLNMALPPSPNFIGEMSILSSLFQWSNFTLIIMGISILFTTSYSLYMFWSTQREYPPLHIKFMPPIHTREHILLALHIIPALLLTIKPGLLF       - Chinese Toad
Sea Lamprey        - MLKLIIPSIMLIPMTFLINKKSLLWTATTFFSFLIAALSTLTLNMDVAEHNSTNPLLSIDQFSCPLIMLSCWLLPLTIMGSQAHMKTEPITRQKTMISLLILLQVLLCITFGASNLLMFYIAFETTLIPTLLIITRWGNQKERLTAGLYFLFYTLSASLP LLLALIMIQTHLNSLSIYIIPLSNLTLLLNTPWSETLWWIACFLAFLIKMPLYIFHLW LPKAHVEAPIAGSMILAAILLKLGGYGMIRMSSLFIPLTKDLAVPFMIIAMWGMIVTSSI  CLRQTDLKSMIAYSSVSHMGLVVAGIFTMTPWAWSGALAMMIAHGLVSSGLLCLANITYERTHTRSIFMNRGLKTLFPLMSFWWLMMTFANMALPPFPNFMAEILIITSLFNWSNWTILLLGLSMTLTALFSLNMLIMTQHEHPNKHAPVNPSTTREHLLMLMHMAPIILLIANPSAIMI       - Sea Lamprey
Sea squirt         - MYLLLLLIMLNMLMMSMIYLFMLFMNKMKNNLNLIIGNLIIINLLLNLFNLNWIDWIYIFCNLSFNMYSYGLIMLTLWIFGLIFISLNNNSLNCLFMNLLLMISLLLVFLSMNLLLFYLFYEFGLLLIFYLVVKWGYSENRWLSGFYLMFYTMIFSLPMLYIIYYIYLIDYSLNFMLMEMLNLNLNMMLFIYLLMSFLVKIPIYLFHGWLLKAHVEAPYYGSMILASIMLKLGGYGMLRLMIIYKNEFILIQKILVMINSFGVLILSLM             CLSQFDMKSIIAISSIVHMGLMIMSMMTFLKISLIGGYLMMISHGLSSSGLFFLVNVIYSQTNSRLMFINKGMINFMPSMSLLWFMLCSSNMGSPVSLNLISEVMLLIGMISWLKFMMLILMMYCLFSFIYSIYLFMFINHGKIFIMFKIKNGILVEYFVLLLHWIPLNLMFLKLYFI         - Sea squirt
Liver Fluke        - MGFQKFDWYCWCLGVGGLVLIKGLLLLLSGIGMWLLGLYYVEFGVFVFDSVSFYFCLLSLFLGISLVFVLSELGLGSKIMLVFSLVSSLLCYCCVNGVWFWCFYEMSILPLLFLLISESPYSERFIASWYLLGYIVFSSLPMLLCILYLGGIMGSYSVQSWSIDCVGFGVFVVLAVMFITKIPLPPFHVWLPIVHAEASSPVSMFLSGYVMKLGLLGVLRFCYFLLSGFIFSYWYVGLSLVFALLFFFSASRELDGKRWLAFLSLAHIVVVSVCFSFCWFDEASLSLVYSLGHGLSAGVTFMLLWLLYEVSGSRNWLVLKSAVSGSLAVRCILVMCVCSVASVPPTVNFFSEVVILSEVGFSWLFYSLLFCVYLFVGGLVPVFLLGCLLSRHCTIGYDRGYVVSYVGGIVFLVVWCYVMFVVL                                              - Liver Fluke
Snail              - MFSMLFGIIAIFFINSWSVSFCSIIVLILISMLSFNQYFFNTMNYIFMYNNISNLLIFLSIMLIGLCFISTPENKKSRYMSCLLSLLFILVLVFSVNNVLLFYIFFEASLIPTLLLIVCWGYQPERLQAGSYMMLYTVRASLPLLMVLLYWSYNEGSFMIILSDTCKYNMYQSMYFIIYLAFLVKLPLYSCHLWLPKAHVEASLAGSMILAGILLKLGGYGLIQMNYIFNISGDKSFFLIFIMSLSIWGGLLSSLM                          CLRQVDLKAFIAYSSIGHMALVIVGILNDQVWGILSSIITMYAHGLSSSALFCIAYFSYMKVRSRSLMHMKGLLQIYPMIAFFWFLLCSVNMAVPPTLNLMGEMFIIPSLWSLSNMFIIVMGLMIFISGVYNMFLYTSINHSMYSKHMLLGIPLSSSQYISLLMHLFPMVLFLKMDLFF        - Snail
Honey Bee          - MYLLLLLIMLNMLMMSMIYLFMLFMNKMKNNLNLIIGNLIIINLLLNLFNLNWIDWIYIFCNLSFNMYSYGLIMLTLWIFGLIFISLNNNSLNCLFMNLLLMISLLLVFLSMNLLLFYLFYEFGLLLIFYLVVKWGYSENRWLSGFYLMFYTMIFSLPMLYIIYYIYLIDYSLNFMLMEMLNLNLNMMLFIYLLMSFLVKIPIYLFHGWLLKAHVEAPYYGSMILASIMLKLGGYGMLRLMIIYKNEFILIQKILVMINSFGVLILSLM             CLSQFDMKSIIAISSIVHMGLMIMSMMTFLKISLIGGYLMMISHGLSSSGLFFLVNVIYSQTNSRLMFINKGMINFMPSMSLLWFMLCSSNMGSPVSLNLISEVMLLIGMISWLKFMMLILMMYCLFSFIYSIYLFMFINHGKIFIMFKIKNGILVEYFVLLLHWIPLNLMFLKLYFI         - Honey bee
Russian grayling   - MMKFLMMMMFMIPLCLKKNMFWMVQNLMMMMAFIFMNMSLNITTFCNLSYMMSCDMISYGLILLSIWISFLMIMASEGLLRSNFYEKFFLFNVIMLLMMLYLTFSSMNLFLFYLFFEASLIPTLMLIIGWGYQPERIQAGLYLLFYTLFASLPLLLSIFYIFSEMNCMMMYFLKFYNYEFIFLYVCLILAFLVKMPMYFVHLWLPKAHVEAPISGSMILAAIMLKLGGYGLLRIMIVLQKIGLKMNIIWVTISLIGGFYISLK                   CFCQIDMKSLIAYSSVCHMSIVIGGIMTMNYWGFIGSYMLMISHGLCSSGMFCLSNINYERLNSRSLFLNSGMLNFMPSMSLWWFLLLSSNMAAPPSLNLAGEISLINSLISWSWLSMILLIMISFFSAGYSLYLYSYTQHGKYNIGLYSFYGGVSREYLMLMLHWLPLNVLIMKIDYSMLWF    - Russian Grayling
Bryozoan           - MLVLCVSPLVVLLALLQASPVALGFNLSLNTNNALLCEMTLILLVIMILCYWSSPLFAFFSVSVCALCAFFFLADNYLVMYASLEGSLIPTVLIINMWGYQPEKITSMLYLLMYTITLSLPLLLVLLSLFTSYTSFSMLWFYLSPAFSPVLWVAVLAFLVKTPIWSVHFWLPRAHVQAPLAGSVILAGALLKLGGWGIYCIVNVYGPHNMYTFFFALALGGGALVVTL                                                      CLRSTDIKSLIAYSSVIHMATMLAGLFTYSLTGWSGALCMMVAHGLTSPAMFILANSNYEINSSRNLLHMKGLATSQPVLMLMWFLTMCSNMSVPPVLSFMSEIMLYASIMSSGTFFGAVAVFLVLGGGAYNLYYYSSFGGSTPLSPTSVKPRWMLMIQTLSLPALTWSLFYLF             - Bryozoan
Rice moth          - MMKFLVMMIFMMPLCFMKNMFWLVQMSLMLMFFLFMNLSVMIYYNMNMSYMYSCDMMSFGLILLSIWICMLMLMASENLLKMNFYVNFFLFNLLFLLIMLYLTFSVMNLFMFYLCFEGSLIPTLMLIIGWGYQPERIQAGMYLLFYTLFASLPLLMGIFYIFKMSNNIMIYFMKFYNFNMYLLYFSMVMAFLVKMPMYFVHLWLPKAHVEAPVSGSMILAGIMLKLGGYGLMRVMIIMEKISLKLNFIWVIISLVGGFYISLK                   CFCQVDMKSLIAYSSVAHMSVVIGGIMTMNYWGYMGSYILMIGHGLCSSGMFCLANINFERLNSRSLYINKGMMNFMPSMSLWWFLLMSSNMAAPPSLNLMGEISLINSLLSWSWMSMIMLMLLSFFSAGYSLYLFSYTQHGKYNMGMYSFYTGVSREYLLLLLHWLPLNLMILKVDFFMIWF    - Rice Moth


BUILD 37.3  NT_034772.6  chromosome 5  chr5:134262350..134263726
BUILD 36.3  NT_034772.5  chromosome 5  chr5:134290249..134291625
                   - MLKLIVPTIMLLPLTWLSKKHMIWINTTTHSLIISTIPLLFFNQINNNLFSCSLSFSSDPLTTPLLMLTTWLLPLTIMASQRHLSNEPLSRKKLYLSMLISLQISLIMTFTAMELIMFYIFFETTLIPTLAIITRWGNQPERLNAGTYFLFYTLVGSLPLLIALIYTHNTLGSLNILLLTLTAQELSNSWANNLMWLAYTMAFMVKMPLYGLHLWLPKAHVEAPIAGSMVLAAVLLKLGGYGMMRLTLILNPLTKHMAYPFLVLSLWGMIMTSSI       CLRQTDLKSLIAYSSISHMALVVTAILIQTPWSFTGAVILMVAHGLTSSLLFCLANSNYERTHSRIMILSQGLQTLLPLMAFWWLLASLTNLALPPTINLLGELSVLVTTFSWSNITLLLTGLNMLITALYSLYMFTTTQWGSLSHHINNMKPSFTRENTLMFMHLSPILLLSLNPDIITGFSS
CRS                - MLKLIVPTIMLLPLTWLSKKHMIWINTTTHSLIISIIPLLFFNQINNNLFSCSPTFSSDPLTTPLLMLTTWLLPLTIMASQRHLSSEPLSRKKLYLSMLISLQISLIMTFTATELIMFYIFFETTLIPTLAIITRWGNQPERLNAGTYFLFYTLVGSLPLLIALIYTHNTLGSLNILLLTLTAQELSNSWANNLMWLAYTMAFMVKMPLYGLHLWLPKAHVEAPIAGSMVLAAVLLKLGGYGMMRLTLILNPLTKHMAYPFLVLSLWGMIMTSSI       CLRQTDLKSLIAYSSISHMALVVTAILIQTPWSFTGAVILMIAHGLTSSLLFCLANSNYERTHSRIMILSQGLQTLLPLMAFWWLLASLANLALPPTINLLGELSVLVTTFSWSNITLLLTGLNMLVTALYSLYMFTTTQWGSLTHHINNMKPSFTRENTLMFMHLSPILLLSLNPDIITGFSS   - Human
                                                        ^                 ^^                              ^                          ^                                                                                                                                                                                                                  ^                                               ^                                    ^                 ^
                              1         2         3         4         5         6         7         8         9       100         1         2         3         4         5         6         7         8         9       200         1         2         3         4         5         6         7                8         9       300         1         2         3         4         5         6         7         8         9       400         1         2         3         4         5         
Differences                                            S36T         P54L T55S                             S86N                      T113M                                                                                                                                                                                                             I318V                                                                               V402I

Comparative phylogeny:

NC_012920 Homo sapiens              Human              Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo
NC_001643 Pan troglodytes           Chimp              Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Pan
NC_006853 Bos taurus                Cattle             Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia; Pecora; Bovidae; Bovinae; Bos
NC_005268 Balaena mysticetus        Bowhead Whale      Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Cetacea; Mysticeti; Balaenidae; Balaena
NC_014682 Orcinus orca              Killer Whale       Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Cetacea; Odontoceti; Delphinidae; Orcinus
NC_007393 Rousettus aegyptiacus     Egyptian Rousette  Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Chiroptera; Megachiroptera; Pteropodidae; Pteropodinae; Rousettus
NC_002080 Erinaceus europaeus       European Hedgehog  Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Insectivora; Erinaceidae; Erinaceinae; Erinaceus
NC_009492 Ailuropoda melanoleuca    Giant Panda        Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Ursidae; Ailuropoda
NC_001794 Macropus robustus         Wallaroo           Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Metatheria; Diprotodontia; Macropodidae; Macropus
NC_008133 Phascolarctos cinereus    Koala              Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Metatheria; Diprotodontia; Phascolarctidae; Phascolarctos
NC_003321 Tachyglossus aculeatus    Australian Echidna Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Monotremata; Tachyglossidae; Tachyglossus
NC_002333 Danio rerio               Zebrafish          Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Cyprinidae; Danio
NC_014764 Protopterus aethiopicus   Marbled Lungfish   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Dipnoi; Lepidosireniformes; Protopteridae; Protopterus
NC_009736 Egretta eulophotes        Chinese Egret      Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Ciconiiformes; Ardeidae; Egretta
NC_006403 Hyla chinensis            Chinese Toad       Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Neobatrachia; Hyloidea; Hylidae; Hylinae; Hylini; Hyla
NC_001626 Petromyzon marinus        Sea Lamprey        Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Hyperoartia; Petromyzontiformes; Petromyzontidae; Petromyzon
NC_004447 Ciona intestinalis        Sea squirt         Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Enterogona; Phlebobranchia; Cionidae; Ciona
NC_001912 Branchiostoma lanceolatum Amphioxus          Eukaryota; Metazoa; Chordata; Cephalochordata; Branchiostomidae; Branchiostoma. 
NC_012616 Apostichopus japonicus    Jap. Sea Cucumber  Eukaryota; Metazoa; Echinodermata; Eleutherozoa; Echinozoa; Holothuroidea; Aspidochirotacea; Aspidochirotida; Stichopodidae; Apostichopus
NC_002546 Fasciola hepatica         Liver Fluke        Eukaryota; Metazoa; Platyhelminthes; Trematoda; Digenea; Echinostomida; Echinostomata; Echinostomatoidea; Fasciolidae; Fasciola
NC_010220 Biomphalaria tenagophila  Snail              Eukaryota; Metazoa; Mollusca; Gastropoda; Pulmonata; Basommatophora; Lymnaeoidea; Planorbidae; Biomphalaria
NC_001566 Apis mellifera ligustica  Honey Bee          Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Hymenoptera; Apocrita; Aculeata; Apoidea; Apidae; Apis
NC_014587 Hipparchia autonoe        Russian Grayling   Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Papilionoidea; Nymphalidae; Satyrinae; Satyrini; Satyrina; Hipparchia
NC_008192 Flustrellidra hispida     Bryozoan           Eukaryota; Metazoa; Bryozoa; Gymnolaemata; Ctenostomata; Flustrellidridae; Flustrellidra