Examples of Comparative Biology

Diagrams for the peptide NAD3 from several species are shown here.
It is unclear for the present as to whether these diagrams should be identical to each other.

Examples of non-synonymous mutations are:

C10069T  A4V
T10081C  M8T
T10084C  I9T   - common
A10086G  N10D  - common
G10143A  G29S  - common
T10114C  I19T
C10128A  L24M
A10188G  M44V
C10192T  S45F  - common
C10192A  S45Y
G10197A  A47T
G10203A  V49I  - common
T10216C  M53T
T10237C  I60T
C10314G  L86V
G10320A  V88I  - common
T10321C  V88A  - common
T10324C  M89T  - common
T10326C  S90P
C10327T  S90L
T10336C  L93S
T10345C  I96T  - common
G10365A  A103T - common
G10373C  E105D
A10398G  T114A - common 

NAD3  Mammal - Human NC_012920
Enlarge

Amino acid sequences for peptide NAD3:-

                               1         2         3         4         5         6         7         8         9         0         1
Mammals:
Human              -  MNFALILMINTLLALLLMIITFWLPQLNGYMEKSTPYECGFDPMSPARVPFSMKFFLVAITFLLFDLEIALLLPLPWALQTTNLPLMVMSSLLLIIILALSLAYEWLQKGLDWTE    - Human 
Chimp              -  MNFVLILMTNTLLALLLMIITFWLPQLNSYMEKSTPYECGFDPMSPARVPFSMKFFLVAITFLLFDLEIALLLPLPWALQTANLPLMVTSSLLLITILALSLAYEWLQKGLDWTE    - Chimp
Cattle             -  MNLMLALLTNFTLATLLVIIAFWLPQLNVYSEKTSPYECGFDPMGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWASQTANLNTMLTMALFLIILLAVSLAYEWTQKGLEWTE    - Cattle
Bowhead Whale      -  MNLLLTLLTNTTLALLLVFIAFWLPQLNVYAEKTSPYECGFDPMGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWAIQTNNLNTMLTMALFLISLLAASLAYEWTQEGLEWAE    - Bowhead Whale
Killer Whale       -  MNLLSTLLTNTTLALLLMLIAFWLPQLNAYAEKTSPYECGFDPMGSARLPFSMKFFLVAITFLLFDLEITLLLPLPWAIQTNNLTTMLLMALFLISLLATSLAYEWTQKGLEWNK    - Killer Whale
Egyptian Rousette  -  MNLMLTLFINTLLASLLVLIAFWMPQMNSYAEKSSPYECGFDPMGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWASQTDNLKIMLIMSLTLISLLAISLAYEWSHKGLEWAE    - Egyptian Rousette
European Hedgehog  -  MTLMIMIFTNTTLAIMLVIIAFYWPQLNAHVEKISPYECGFDPLGSARLPFSMKFFLVAITFLLFDLEIALLLPIPWLMNSSNTTTSIMIVLILIMALASSLAYEWMKEGLEWK     - European Hedgehog
Yellow-t Marten    -  MNMMLTMLINVSLASLLVLIAFWLPQLNIYTEKASPYECGFDPLGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWASQSINLKTTLIMALALISLLALSLAYEWTEEGLEWNE    - Yellow Throated Marten
Spotted Seal       -  MNMALTLFTNTALASLLVLIAFWLPQLNTYSEKASPYECGFDPMGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWASHTDNLTTMLTMALLLISLLAASLAYEWTEKGLEWTE    - Spotted Seal
Giant Panda        -  MNLILALLTNVLLASLLVLIAFWLPQLNIYAEKVSPYECGFDPMGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWALQTNNLMTMLIMALLLISLLAASLAYEWTEKGLEWAE    - Giant Panda
Wallaroo           - MINLIITLIINTALSTIIVLIAFWLPQLYLYLEKSSPYECGFDPLGSARLPFSMKFFLIAITFLLFDLEIALLLPLPWAMQLPTPNLTLILAYCLIILLTAGLAYEWIQKGLEWSE    - Wallaroo
Koala              - MINLLITLIVNFMLSTIIILIAFWLPQLYLYLEKSSPYECGFDPLGSARLPFSLKFFLVAITFLLFDLEIALLLSLPWALQLPHPNMTLVLSYCLIVLLTAGLAYEWSQKGLEWTE    - Koala
Numbat             -  MNLILMLLTNSLLATVVVLIAFWLPQLYLYLEKSSPYECGFDPLGSARLPFSMKFFLVAITFLLFDLEIALLLPLPWAMQFTTTSTMLTLSFSLIILLTAGLAYEWFQKGLEWTE   -  Numbat
Australian Echidna -  MNLLISLLINTCLATILVVVAFWLPQLYTYLEKSSPYECGFDPLGSARLPFSLKFFLVAITFLLFDLEIAILLPLPWASQTSSPYLLLGLSGVLLTLLTLGLAYEWLQKGLEWTE    - Australian Echidna

Non-mammals:
Zebrafish          - MNLFATILIIMTTLSLVLALVSFWLPQMNSDTEKLSPYECGFDPLGSARLPFSLRFFLVAVLFPLFDLEIALLLPLPWGDQLNNPMETLFWAMTVLILLTLGLAYEWAQGGLEWAE    - Zebrafish
MarbledLungfish    -  MNLLIIMAISTILPIILMLLGFWLPTLNPDNEKVSPYECGFDPLGSARLPFSLKFFLVAILFLLFDLEIAILLPLPWALQSTAPIITFLTALLILILLTLGLIYEWLQGGLEWAE     - Marbled Lungfish
Green Anole        -  MNLSSMILITMTISIVLIIISFWLPQLNSDTEKLSPYECGFDPLGNARLPFSLRFFLVAILFLLFDLEIALLLPLPWAINLGSPLQTSTLTSAILVLLTLGLVYEWLQGGLEWAE     - Green Anole
Amphioxus          - MLSLTYIVGIASALVIILLLVGLHLPSVMPDNEKLSAYECGFDPMGNARLPFSLRFFLVAILFLLFDLEIALILPYPLGVVFSENTFYNYWLVMLLVVVLTFGLMYEWLKGGLEWTE   - Amphioxus
Liver Fluke        - MLFFAVLGLLFFLIFFLVLVLHAFLWNLDLGIFSGERSWVSSFECGFLSQRVTENYFSYTYFILLVFFVVFDLEVSLLLNMPLQGVLYKNFFSYLFFLVLLGIGFLVEVRRGYVRWTY  - Liver Fluke
Bryozoan           - MCTWCYHVSTLLLLLITTMTATYQSTEKLSAFECGFHSFDYRTPFSVRFSLLAVVFLVFDAEVALLMPLFLSSMAGMNFQMIAGGVFFLILWAGLIYEWFQGSLSWVI            - Bryozoan

Comparative phylogeny:

NC_012920  Homo sapiens              Human              Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo
NC_001643  Pan troglodytes           Chimp              Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Pan
NC_006853  Bos taurus                Cattle             Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia; Pecora; Bovidae; Bovinae; Bos
NC_005268  Balaena mysticetus        Bowhead Whale      Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Cetacea; Mysticeti; Balaenidae; Balaena
NC_014682  Orcinus orca              Killer Whale       Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Cetacea; Odontoceti; Delphinidae; Orcinus
NC_007393  Rousettus aegyptiacus     Egyptian Rousette  Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Chiroptera; Megachiroptera; Pteropodidae; Pteropodinae; Rousettus
NC_002080  Erinaceus europaeus       European Hedgehog  Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Insectivora; Erinaceidae; Erinaceinae; Erinaceus
FJ719367   Martes flavigula          Yellow-t Marten    Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Mustelidae; Martinae; Martes
FJ895151   Phoca largha              Spotted Seal       Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Phocidae; Phoca
NC_009492  Ailuropoda melanoleuca    Giant Panda        Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Ursidae; Ailuropoda
NC_001794  Macropus robustus         Wallaroo           Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Metatheria; Diprotodontia; Macropodidae; Macropus
NC_008133  Phascolarctos cinereus    Koala              Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Metatheria; Diprotodontia; Phascolarctidae; Phascolarctos
FJ515782   Myrmecobius fasciatus     Numbat             Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Metatheria; Dasyuromorphia; Myrmecobiidae; Myrmecobius.
NC_003321  Tachyglossus aculeatus    Australian Echidna Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Monotremata; Tachyglossidae; Tachyglossus
NC_002333  Danio rerio               Zebrafish          Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Cyprinidae; Danio
NC_014764  Protopterus aethiopicus   Marbled Lungfish   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Dipnoi; Lepidosireniformes; Protopteridae; Protopterus
NC_009736  Egretta eulophotes        Chinese Egret      Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Ciconiiformes; Ardeidae; Egretta
NC_006403  Hyla chinensis            Chinese Toad       Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Neobatrachia; Hyloidea; Hylidae; Hylinae; Hylini; Hyla
EU747728.2 Anolis carolinensis       Green Anole        Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Lepidosauria; Squamata; Iguania; Iguanidae; Polychrotinae; Anolis
NC_001626  Petromyzon marinus        Sea Lamprey        Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Hyperoartia; Petromyzontiformes; Petromyzontidae; Petromyzon
NC_004447  Ciona intestinalis        Sea squirt         Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Enterogona; Phlebobranchia; Cionidae; Ciona
NC_001912  Branchiostoma lanceolatum Amphioxus          Eukaryota; Metazoa; Chordata; Cephalochordata; Branchiostomidae; Branchiostoma. 
NC_012616  Apostichopus japonicus    Jap. Sea Cucumber  Eukaryota; Metazoa; Echinodermata; Eleutherozoa; Echinozoa; Holothuroidea; Aspidochirotacea; Aspidochirotida; Stichopodidae; Apostichopus
NC_002546  Fasciola hepatica         Liver Fluke        Eukaryota; Metazoa; Platyhelminthes; Trematoda; Digenea; Echinostomida; Echinostomata; Echinostomatoidea; Fasciolidae; Fasciola
NC_010220  Biomphalaria tenagophila  Snail              Eukaryota; Metazoa; Mollusca; Gastropoda; Pulmonata; Basommatophora; Lymnaeoidea; Planorbidae; Biomphalaria
NC_001566  Apis mellifera ligustica  Honey Bee          Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Hymenoptera; Apocrita; Aculeata; Apoidea; Apidae; Apis
NC_014587  Hipparchia autonoe        Russian Grayling   Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Papilionoidea; Nymphalidae; Satyrinae; Satyrini; Satyrina; Hipparchia
NC_008192  Flustrellidra hispida     Bryozoan           Eukaryota; Metazoa; Bryozoa; Gymnolaemata; Ctenostomata; Flustrellidridae; Flustrellidra