Examples of Comparative Biology

Diagrams for the peptide NAD1 from several species are shown here.
It is unclear for the present as to whether these diagrams should be identical to each other.

Examples of non-synonymous mutations are:

3307.1A  - "A2i"
3308C"   - "A2i";              M1T    T>C
3316A"   - "D1e";              A4T    G>A
3338C"   - "T2b8"              V11A   T>C
3391A"   - "D4c1a"             G29S   G>A
3394C"   - "C4a4"              Y30H   T>C
3397G"   - "M27c"              M31V   A>G
3398C"   - "I2a"               M31T   T>C
3421A"   - "D4n"               V39I   G>A
3434G"   - "F3, L1c3b1 & L2d"  Y43C   A>G
3460A    - LHON                A52T   G>A
3496T"   - "D5a1"              A64S   G>T  !
3497T"   - "B4c1"              A64V   C>T
3505G"   - "W"                 T67A   A>G
3535A"   - "U5b3e"             L77M   T>A  !
3547G"   - "B2 & HV1b2"        I81V   A>G
3565G"   - "R24"               T87A   A>G
3571T"   - "B4c1b2"            L89F   C>T
3593C"   - "D4d & S5"          V96A   T>C
3644C"   - "D4h, L0f1, & M13a" V113A  T>C
3688C"   - "U6c"               A128P  G>C  !
3736A"   - "N11b"              V144I  G>A
3796G"   - "B2f, H1b, M21a"    T164A  A>G
3796T"   - "L1c1"              T164S  A>T  !
3866C"   - "L0a1a"             I187T  T>C
3992T"   - "H4"                T229M  C>T
4012G"   - "L0a2c"             T236A  A>G
4024G"   - "H4a"               T240A  A>G
4025T"   - "U2d"               T240M  C>T
4048A"   - "M7b"               D248N  G>A
4079G"   - "M333c"             Y258C  A>G
4093G"   - "U2b1"              T263A  A>G
4129G"   - "N9a3"              T275A  A>G
4136G"   - "C4b7 & R8b2"       Y277C  A>G
4172A"   - "U6a1a"             L289Q  T>A  !
4205C"   - "R8a1a2"            L300S  T>C
4216C"   - "D5c & R2JT"        Y304H  T>C
4225G"   - "L0d2a";            M307V  A>G
4232C"   - "L0d, L4b1 & R30a"  I309T  T>C
4234T"   - "M35b1"             T310S  A>T  !

NAD1  Mammal - Human NC_012920
Enlarge

Amino acid sequences for peptide NAD1:-

                                      1         2         3         4         5         6         7         8         9         0         1         2         3           4         5         6         7         8         9       200         1         2         3         4         5         6         7         8         9       300         1
Mammals:
Human              -         MPMANLLLLIVPILIAMAFLMLTERKILGYMQLRKGPNVVGPYGLLQPFADAMKLFTKEPLKPATSTITLYITAPTLALTIALLLWTPLPMPNPLVNLNLGLLFILATSSLAVYSILWSGWASNSNYALIGALRAVA  QTISYEVTLAIILLSTLLMSGSFNLSTLITTQEHLWLLLPSWPLAMMWFISTLAETNRTPFDLAEGESELVSGFNIEYAAGPFALFFMAEYTNIIMMNTLTTTIFLGTTYDALSPELYTTYFVTKTLLLTSLFLWIRTAYPRFRYDQLMHLLWKNFLPLTLALLMWYVSMPITISSIPPQT       - Human 
'Altai'            -         MPMANLLLLIVPILIAMAFLMLTERKILGYMQLRKGPNIVGPYGLLQPFADAMKLFTKEPLKPSTSTITLYITAPTLALTIALLLWTPLPMPNPLVNLNLGLLFILATSSLAVYSILWSGWASNSNYALIGALRAVA  QTISYEVTLAIILLSMLLMSGSFNLSTLITTQEHLWLLLPSWPLAMMWFISTLAETNRTPFDLAEGESELVSGFNIEYAAGPFALFFMAEYTNIIMMNTLTTTIFLGTTYNALSPELYTTYFVTKTLLLTSLFLWIRTAYPRFRYDQLMHLLWKNFLPLTLALLMWYVSMPITISSIPPQT       - Altai
Chimp              -         TPMTNLLLLIVPILIAMAFLMLTERKILGYMQLRKGPNIVGPYGLLQPFADAMKLFTKEPLKPSTSTITLYITAPTLALTIALLLWTPLPMPNPLVNLNLGLLFILATSSLAVYSILWSGWASNSNYALIGALRAVA  QTISYEVTLAIILLSTLLMSGSFNLSTLVTTQEHLWLILPTWPLAMMWFISTLAETNRTPFDLTEGESELVSGFNIEYAAGPFALFFMAEYMNIIMMNTLTATIFLGATYNTHSPELYTTYFVTKALLLTSLFLWIRTAYPRFRYDQLMHLLWKNFLPLTLASLMWYISMPTTISSIPPQT       - Chimp
White-t-e Marmoset -         MFMVNLILLIVPALIAMAFLTLMERKVLGYMQLRKGPNIVGPYGTLQPIADAMKLFTKEPLLPTTSTTTLYLTAPTLALSIALLLWTPLPMPYPLINLNLGLLFILATSSLAVYSILWSGWASNSNYALIGALRAVA  QTISYEVTLAIILLSTLLMSGSFNLQSLITTQEHYWLLLPSWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNIEYAAGSFALFFMAEYMNIIMMNALTTTIFLATSFNTTMPEMYTINFMTKTLLLTTLFLWIRTAYPRFRYDQLMYLLWKNFLPLTLALCMWYISVPILMSGIPPQT       - White Tufted Ear Marmoset
Cattle             -         MFMINILMLIIPILLAVAFLTLVERKVLGYMQLRKGPNVVGPYGLLQPIADAIKLFIKEPLRPATSSASMFILAPIMALGLALTMWIPLPMPYPLINMNLGVLFMLAMSSLAVYSILWSGWASNSKYALIGALRAVA  QTISYEVTLAIILLSVVLMSGSFTLSTLITTQEQMWLILPAWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFMAEYANIIMMNIFTAILFLGTSHNPHMPELYTINFTIKSLLLTMSFLWIRASYPRFRYDQLMHLLWKNFLPLTLALCMWHVSLPILTSGIPPQT       - Cattle
Goat               -         MFMINILTFIIPILLAVAFLTLVERKVLGYMQLRKGPNVVGPYGLLQPIADAIKLFIKEPLRPATSSISMFILAPILALTLALTMWIPLPMPYPLINMNLGVLFMLAMSSLAVYSILWSGWASNSKYALIGALRAVA  QTISYEVTLAIILLSILLMNGSFALSTLIITQEQVWLIFPAWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFMAEYANIIMMNIFTTTLFLGAFHSPYMPELYTINFIIKSLLLTITFLWIRASYPRFRYDQLMHLLWKNFLPLTLALCMWHVSLPILLSSIPPQT       - Goat
Mammuthus primig.  -         MFLINVLTVTLPILLAVAFLTLVERKALGYMQLRKGPNVVGPYGLLQPIADAIKLFTKEPVYPQTSSKFLFTVAPILALTLALTVWAPLPMPYPLINLNLSLLFILAMSSLMVYSILWSGWASNSKYALMGALRAVA  QTISYEVSMTTIILSMVLMNGSFTLTAFATTQEHLWLIFPMWPLMMMWFTSTLAETNRAPFDLTEGESELVSGFNVEYSAGPFALFFMAEYANIIMMNALTVILFMGTSCNPQMPEISTINFVVKTIILTICFLWVRASYPRFRYDQLMYLLWKNFLPLTLALCMWHISILISLACIPPQA       - Mammuthus primig.
Bowhead Whale      -         MFMINILTLILPILLAVAFLTLVERKILGYMQFRKGPNIVGPHGLLQPFADAIKLFTKEPLRPATSSTTMFIIAPVLALALALTMWSPLPMPYPLINMNLGVLFMLAMSSLAVYSILWSGWASNSKYALIGALRAVA  QTISYEVTLAIILLSVLLMNGSFTLSTLATTQEQLWLIFPTWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFLAEYANIIMMNMFTAILFLGTFHDPYTPELYTTNLITKTLLLTMSFLWIRASYPRFRYDQLMHLLWKSFLPLTLALCMWHISLPIMTASIPPQT       - Bowhead Whale
Killer Whale       -         MFMINILTLTLPILLAVAFLTLVERKILGYMQFRKGPNIVGPYGLLQPFADAIKLFTKEPLRPATSSTTMFMIAPVLALTLALTMWTPLPMPYPLINMNLGVLFMLAMSSLTVYSILWSGWASNSKYALIGALRAVA  QTISYEVTLAIILLSVLLMNGSFTLSTLNTTQEKLWLLFPSWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFLAEYANIIMMNMFTTILFLGAFHNPYTPELCTTNLITKSLLLTMSFLWIRASYPRFRYDQLMQLLWKNFLPLTLALCMWHISLPIMTASIPPQT       - Killer Whale
Egyptian Rousette  -         MFIINLLALIIPILLAVAFLTLIERKVLGYMQLRKGPNVVGPYGLLQPAADAVKLFTKEPLRPLTSSPSMFIIAPILALTLALTMWIPLPMPHPLINMNLAVLFMLALSSLAVYSILWSGWASNSKYALIGALRAVA  QTISYEVTLAIILLSVLLLSGSFSLSTLIITQEYTWLILSSWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAGGPFALFFMAEYANIIMMNILTATLFMGAYHNPLMPELHSINLTIKVLLLTVLFLWIRASYPRFRYDQLMHLLWKNFLPLTLALCMWHVAMPITMASIPPQT       - Egyptian Rousette
European Hedgehog  -         MLMINILCLIIPILLAVAFLTLIERKVLGYMQLRKGPNIVGSFGLLQPIADAVKLFTKEPILPITSSLFLFVAAPILAITLALMLWVPMPMPQPLININLNLLFILALSSLAVYSILWSGWASNSKYALIGGLRAVA  QTISYEVTLAIILLSLLMFNGSFSLNNFIYTQENLWLLVSTWPLMMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFLAEYANIIMMNALTVILFLAPSNSMYLPEMFTMKFMPMIILMTMLFLWVRASYPRFRYDQLMHLLWKNFLPLTLALCMWYTSLPITLASFPPQ        - European Hedgehog
Giant Panda        -         MFMINIFSLIVPILLAVAFLTLVERKVLGYMQLRKGPNIVGPYGLLQPIADAVKLFTKEPLRPLTSSMTMFIMAPILALTLALTMWVPLPMPHPLINMNLGVLFMLAMSSLAVYSILWSGWASNSKYALIGALRAVA  QTISYEVTLAIILLSVLLMNGSFTLSTLIITQEHLWLIFPAWPLAMMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFLAEYANIIMMNALTTILFFGAFHSPYMPELYIVNFTVKTLLLTISFLWIRASYPRFRYDQLMHLLWKNFLPLTLALCMWHVTLPIITASIPPQT       - Giant Panda
Wallaroo           -         MFVINLLLYIVPILLAVAFLTLVERKVLGYMQFRKGPNIVGPYGLLQPIADAVKLFTKEPLRPLTSSVSMFIIAPILALTLALTIWTPLPMPHALIDLNLGLLFILSLSGLSVYSILWSGWASNSKYALIGALRAVA  QTISYEVTLAIILLSIMLINGSFTLKNLIITQENMWLIVATWPLAMMWYISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFAMFFLAEYANIMAMNAMTAILFLGSSLNHNLSHLNTLSFMLKTLFLTFMFLWIRASYPRFRYDQLMHLLWKNFLPLTLALCLWFISIPIALSCIPPQI       - Wallaroo
Koala              -         MLTINILLYTFPILLAVAFLTLVERKVLGYMQLRKGPNIVGPYGLLQPVADAVKLFTKEPSRPATSSTLMFITAPIMALTLALTIWVPLPMPHALIDLNLGVLFILTLSGLSVYPILWSGWASNSKYALIGALRAVA  QTISYEVTLAMILLSITLINGSYTLKNLAITQENMWLLVSTWPLAMMWFISTLAETNRTPFDLTEGESELVSGFNVEYSAGPFAMFFLAEYTNILAMNAMTTILFLGSPINHNFTHINTLSFTLKTLMLTFLFLWIRASCPRFRYDQLMHLLWKNFLPLTLAFCLWYISIPIALSCIPPQI       - Koala
Australian Echidna -         MFLINLLLLIVPVLLAVAFLTLIERKILGYMQFRKGPNIVGPHGLLQPIADAVKLFIKEPLRPLTSSIYMFILAPILALSLALTIWVPLPMPLPLIDLNLGLLFILSVSGLSVYSILWSGWASNSKYALTGALRAVA  QTISYEVTFAIILLSIMLINGSFTLTTLNLTQEFMWLVVPTWPLMLMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFAMFFLAEYANIIIMNALTVILFFGTYHLIFLPELSTTNFMVKTMLLTSLFLWVRASYPRFRYDQLMHLLWKNFLPITLVTCLWYIMFPTMLSGTPPQM       - Australian Echidna

Non-mammals:
Zebrafish          -   MLDILTSHLINPLAYAVPVLIAVAFLTLVERKVLGYMQLRKGPNVMGPRGLLQSVADGVKLFIKEPIRPSMASPILFLTAPVLALILAMMLWAPMPMPYPVLDLNLGILFIMAISSLAVYSILGSGWASNSKYALIGALRAVA  QTISYEVSLGLILLSAVIFSGGYTLQTFNTTQEDTWLLLPLWPLAIMWFISTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFLAEYSNILLMNTHSTVLFLGASFTPDAPELMTISIATKTAMLSILFLWMRASYPRFRYDQLMHLIWKNFLPITLVLVLWHIALPIALAGLPPQT       - Zebrafish
Silurus lanzhou.   -   MLTLLMPHVINPLASIVPVLLAVAFLTLIERKVLGYMQLRKGPKVVGPYGLLQPIADGVKLFIKEPVRPSTSSPFLFLITPMLALALAMTLWAPMPIPHPVTDLNLGMLFILALSSLAVYSILGSGWASNSKYALIGALRAVA  QTISYEVSLGLILLSIIIFTGGFTLQMFSTTQETIWLLLPAWPLAAMWYISTLAETNRAPFDLTEGESELVSGFNVEYAGGPFALFFLAEYANILLMNTLSAILFLGATHIPTMPELASANIMTKAALLSMLFLWVRASYPRFRYDLLMHLVWKNFLPMTLALILWHAALPIAFTGLPPQL       - Silurus lanzhou.
Crested myna       -  MTNHPMLINLIMALSYALPILIAVAFLTLVERKILSYMQGRKGPNIVGPFGLLQPLADGIKLFIKEPIRPSTSSPFLFMATPMLALLLAISIWTPLPMPFPLADLNLGLLFLVTMSSLAVYSILWSGWASNSKYALIGALRAVA  QTISYEVTLAIILLSVVLLSGDYTLGTPAVTQEPLYLIFACWPLAMMWYVSTLAETNRAPFDLTEGESELVSGFNVEYAAGPFALFFLAEYANIMLMNTLTALLFFNPSALNPPPELYPVILATKVLLLSAGFLWIRASYPRFRYDQLMHLLWKNFLPLTLALCLWHISLPISYAGLPPYM       - Crested myna
Hydra oligactis    - MKNLYFILLEIIKLLIIIIPVLISVAYLTLAERKILGYSQNRKGPNVVGVYGLLQPLADGVKLFSKELIIPNHVNIFLYLFSPILALTLSLVIWIIIPLGNNNLIFDFNLGIMFIFAISSINIYSILLSGWSSNSKYAFLGSLRAAAQMISYEVCISLIIFSCILCSGSLNISSLINCQSQSISYIFPLWPIAIMFFICSLAETNRAPFDLTEGESELVSGYNVEYSSMSFALFFLAEYSHIIFTSAFFVILFLGSWNNYFFINNLIFFTKLILFTFFFIWIRTSFPRLRYDQLMGLLWKSYLPLSLSFIIFTNSLLWAFWGLSYKWCI      - Hydra oligactis
Euphyllia ancora   -   MFVEVVHLFLKILMVLVPLLITVAYLTLAERKVLGYMQARKGPNVVGVSGLAQPFADGLKLFTKEMVIPHQTNLFIYIVAPVLSFTLALVVWGVVPYGRGVLISDLKIGVLYILAVSSISVYAILMSGWASNSKYAFLGAIRAAAQMISYEVSIGLIIISVLLCVGSLSVTEIVLAQNSGVWFFFPLFPVTIMFFASALAETNRAPFDLTEGESELVSGYNVEYASMSFALFFLAEYAHIILMSCLTTIFFLGGWLSPVKYLKGGAGWFGLKVVLIIFLFIWVRASFPRIRYDQLMSLLWKAYLPLSLGVVTFVASVLFGLNGPPPI      - Euphyllia ancora
Dendronephthya gig.-   MMSTIISIIFKTLAIIIPLLVAIAYLTLAERKVLGYMQARKGPNVVGVYGLLQPLADGLKLFTKEMAIPNHANLSVYIVAPILSLTLAFLAWGVIPFSPGIVLADINVGILYIFAISSIGVYAILMSGWGSNSKYAFLGAIRAAAQMISYEVCIGLILISVILCAGSLNITKVVLAQAEIWYIIPLFPAALMFFASALAETNRAPFDLTEGESELVSGYNVEYSSMSFALFFLAEYGHIILMSCLISLLFLGGWAPFTGILGMGCLALKTTVVVFAFVWVRASFPRMRYDQLMYLLWKSYLPFSLGLIVLVSGLLIGLDAVPC          - Dendronephthya gigantea

Drosophila alstonvl-     MEFILSLIGSLLLIICVLVSVAFLTLLERKVLGYIQIRKGPNKVGLMGIPQPFCDAIKLFTKEQTYPLLSNYLSYYISPIFSLFLSLFVWMCMPFFVKLYSFNLGGLFFLCCTSLGVYTVMVAGWSSNSNYALLGGLRAVA  QTISYEVSLALILLSFIFLIGSYNMIYFFFYQVYMWFLIILFPMALVWMSISLAETNRTPFDFAEGESELVSGFNVEYSSGGFALIFMAEYASILFMSMLFCVIFLGCDVFNLLFYMKLTFISFVFIWVRGTLPRFRYDKLMYLAWKCFLSFSLNYLLFFIGFKILLFSLL                 - Drosophila alstonvl
Drosophila brownsvl-     MEFILSLIGSLLLIICVLVSVAFLTLLERKVLGYIQIRKGPNKVGLMGIPQPFCDAIKLFTKEQTYPLLSNYLSYYISPIFSLFLSLFVWMCMPFFVKLYSFNLGGLFFLCCTSLGVYTVMVAGWSSNSNYALLGGLRAVA  QTISYEVSLALILLSFIFLIGSYNMIYFFFYQVYMWFLIILFPMALVWMSISLAETNRTPFDFAEGESELVSGFNVEYSSGGFALIFMAEYASILFMSMLFCVIFLGCDVFNLLFYMKLTFISFVFIWVRGTLPRFRYDKLMYLAWKCFLSFSLNYLLFFIGFKILLFSLL                 - Drosophila brownsvl
Drosophila dahomey -     MEFILSLIGSLLLIICVLVSVAFLTLLERKVLGYIQIRKGPNKVGLMGIPQPFCDAIKLFTKEQTYPLLSNYLSYYISPIFSLFLSLFVWMCMPFFVKLYSFNLGGLFFLCCTSLGVYTVMVAGWSSNSNYALLGGLRAVA  QTISYEVSLALILLSFIFLIGSYNMIYFFFYQVYMWFLIILFPMALVWMSISLAETNRTPFDFAEGESELVSGFNVEYSSGGFALIFMAEYASILFMSMLFCVIFLGCDVFNLLFYMKLTFISFVFIWVRGTLPRFRYDKLMYLAWKCFLSFSLNYLLFFIGFKILLFSLL                 - Drosophila dahomey
Drosophila japan   -     MEFILSLIGSLLLIICVLVSVAFLTLLERKVLGYIQIRKGPNKVGLMGIPQPFCDAIKLFTKEQTYPLLSNYLSYYISPIFSLFLSLFVWMCMPFFVKLYSFNLGGLFFLCCTSLGVYTVMVAGWSSNSNYALLGGLRAVA  QTISYEVSLALILLSFIFLIGSYNMIYFFFYQVYMWFLIILFPMALVWMSISLAETNRTPFDFAEGESELVSGFNVEYSSGGFALIFMAEYASILFMSMLFCVIFLGCDVFNLLFYMKLTFISFVFIWVRGTLPRFRYDKLMYLAWKCFLSFSLNYLLFFIGFKILLFSLL                 - Drosophila japan
Drosophila mysore  -     MEFILSLIGSLLLIICVLVSVAFLTLLERKVLGYIQIRKGPNKVGLMGIPQPFCDAIKLFTKEQTYPLLSNYLSYYISPIFSLFLSLFVWMCMPFFVKLYSFNLGGLFFLCCTSLGVYTVMVAGWSSNSNYALLGGLRAVA  QTISYEVSLALILLSFIFLIGSYNMIYFFFYQVYMWFLIILFPMALVWMSISLAETNRTPFDFAEGESELVSGFNVEYSSGGFALIFMAEYASILFMSMLFCVIFLGCDVFNLLFYMKLTFISFVFIWVRGTLPRFRYDKLMYLAWKCFLSFSLNYLLFFIGFKILLFSLL                 - Drosophila mysore
Apatura metis      -  MMYMDLMNIMVGLLILVIGVLIGVAFLTLMERKILGYIQIRKGPNKMGYMGILQPFCDAIKLFSKEQIYLNYSNYLVYYISPIMSFILSLLLWVLIPYMFNMIMFNLGLLFFLCCTSMGVYTVMIAGWSSNSNYSLLGGLRSVA  QTISYEVSLFLILMSSIIMIMDFNLLMFFNYQIMIWLIFLMMPLGLCFLSSLMAETNRTPFDFAEGESELVSGFNIEYGGGGFALIFLAEYSSILFMSLLFVIIYMGGYYLNLMFYLKLVFLSFFFVWVRGTLPRYRYDKLMYLCWKSYLPVSLNYLMFFIGLKMILNY                   - Apatura metis (a Butterfly)

Comparative phylogeny:

NC_012920 Homo sapiens              Human              Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo
NC_001643 Pan troglodytes           Chimp              Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Pan
AB572419  Callithrix jacchus        White-t-e Marmoset Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Platyrrhini; Cebidae; Callitrichinae; Callithrix
NC_006853 Bos taurus                Cattle             Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia; Pecora; Bovidae; Bovinae; Bos
GU295658  Capra hircus              Goat               Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia; Pecora; Bovidae; Caprinae; Capra                        
NC_005268 Balaena mysticetus        Bowhead Whale      Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Cetacea; Mysticeti; Balaenidae; Balaena
NC_014682 Orcinus orca              Killer Whale       Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Cetacea; Odontoceti; Delphinidae; Orcinus
NC_007393 Rousettus aegyptiacus     Egyptian Rousette  Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Chiroptera; Megachiroptera; Pteropodidae; Pteropodinae; Rousettus
NC_002080 Erinaceus europaeus       European Hedgehog  Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Insectivora; Erinaceidae; Erinaceinae; Erinaceus
NC_009492 Ailuropoda melanoleuca    Giant Panda        Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Ursidae; Ailuropoda
NC_001794 Macropus robustus         Wallaroo           Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Metatheria; Diprotodontia; Macropodidae; Macropus
NC_008133 Phascolarctos cinereus    Koala              Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Metatheria; Diprotodontia; Phascolarctidae; Phascolarctos
NC_003321 Tachyglossus aculeatus    Australian Echidna Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Monotremata; Tachyglossidae; Tachyglossus
NC_002333 Danio rerio               Zebrafish          Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Cyprinidae; Danio
JF895472  Silurus lanzhouensis                         Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Siluriformes; Siluridae; Silurus
NC_014764 Protopterus aethiopicus   Marbled Lungfish   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Dipnoi; Lepidosireniformes; Protopteridae; Protopterus
NC_009736 Egretta eulophotes        Chinese Egret      Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Ciconiiformes; Ardeidae; Egretta
NC_006403 Hyla chinensis            Chinese Toad       Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Neobatrachia; Hyloidea; Hylidae; Hylinae; Hylini; Hyla
NC_001626 Petromyzon marinus        Sea Lamprey        Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Hyperoartia; Petromyzontiformes; Petromyzontidae; Petromyzon
NC_004447 Ciona intestinalis        Sea squirt         Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Enterogona; Phlebobranchia; Cionidae; Ciona
NC_001912 Branchiostoma lanceolatum Amphioxus          Eukaryota; Metazoa; Chordata; Cephalochordata; Branchiostomidae; Branchiostoma. 
NC_012616 Apostichopus japonicus    Jap. Sea Cucumber  Eukaryota; Metazoa; Echinodermata; Eleutherozoa; Echinozoa; Holothuroidea; Aspidochirotacea; Aspidochirotida; Stichopodidae; Apostichopus
NC_002546 Fasciola hepatica         Liver Fluke        Eukaryota; Metazoa; Platyhelminthes; Trematoda; Digenea; Echinostomida; Echinostomata; Echinostomatoidea; Fasciolidae; Fasciola
NC_010220 Biomphalaria tenagophila  Snail              Eukaryota; Metazoa; Mollusca; Gastropoda; Pulmonata; Basommatophora; Lymnaeoidea; Planorbidae; Biomphalaria
NC_001566 Apis mellifera ligustica  Honey Bee          Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Hymenoptera; Apocrita; Aculeata; Apoidea; Apidae; Apis
NC_014587 Hipparchia autonoe        Russian Grayling   Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Papilionoidea; Nymphalidae; Satyrinae; Satyrini; Satyrina; Hipparchia
NC_008192 Flustrellidra hispida     Bryozoan           Eukaryota; Metazoa; Bryozoa; Gymnolaemata; Ctenostomata; Flustrellidridae; Flustrellidra
EU237491  Hydra oligactis                              Eukaryota; Metazoa; Cnidaria; Hydrozoa; Hydroida; Anthomedusae; Hydridae; Hydra
JF825139  Euphyllia ancora                             Eukaryota; Metazoa; Cnidaria; Anthozoa; Hexacorallia; Scleractinia; Caryophylliina; Caryophylliidae; Euphyllia.
FJ372991  Dendronephthya gigantea                      Eukaryota; Metazoa; Cnidaria; Anthozoa; Octocorallia; Alcyonacea; Alcyoniina; Nephtheidae; Dendronephthya.