Examples of Comparative Biology

Diagrams for the peptide CYTB from several species are shown here.

Examples of non-synonymous mutations are:
T14766C  - giving 'T7I'  (Defines Haplogroups HV0 & H, etc.)
A14769G  - giving 'N8S'
A14793G  - giving 'H16R' (defines Haplogroup U5a etc.)
T14798C  - giving 'F18L'
A14927G  - giving 'T61A'
T14979C  - giving 'I78T'
A15218G  - giving 'T158A' (defines Haplogroup U5a1, etc)
A15326G  - giving 'T194A' (defines Haplogroup H2a2a etc.)

CYTB  Mammal - Human NC_012920
Enlarge

Egyptian Rousette  Mammal - Egyptian Rousette - NC_007393
Enlarge

Koala  Marsupial - Koala - NC_008133
Enlarge

Zebrafish  Fish - Zebrafish - NC_002333
Enlarge

Sea Lamprey  Lamprey - Sea Lamprey - NC_001626
Enlarge

Bryozoan  Bryozoan - NC_008192
Enlarge

Amino acid sequences for peptide CYTB:-


                                   1         2         3         4         5         6         7         8  *      9      *100         1         2         3         4         5         6         7         8 *       9     * 200         1         2         3         4         5         6         7         8         9       300         1         2         3         4         5         6         7         8
The 4 amino acids, 83, 97, 182,196, marked * are 'conserved' Histidine, and are strongly positively charged and attach to 'heme' units.) 

Human variation:  Jun 2011

Observed changes    -      A    IS       R L      P   T         T  V       L   D    T A       TA       V   F   S   L  Y    V          H  A  T     FTA TA  T                       V HV AG    T      NN        L  TS   VTT TA    L            A N    S         T     LI P  M   L     S   T  P D  D                           I    M FFV TL  V  VP     V      A   F  TNF V   V    ANH   V   MT     A   V   AV  V       T   - >
                    -      I                                       M                                   T                   M                                                      T  T       V      G                                          Y                     F F            D                                                T  T  T  T      T                 T        MT                                   P   - >
                    -                                                                                                                                                                                                                                                P                                                                                                                                               V   - >
Human               -     MTPMRKTNPLMKLINHSFIDLPTPSNISAWWNFGSLLGACLILQITTGLFLAMHYSPDASTAFSSIAHITRDVNYGWIIRYLHANGASMFFICLFLHIGRGLYYGSFLYSETWNIGIILLLATMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTDLVQWIWGGYSVDSPTLTRFFTFHFILPFIIAALATLHLLFLHETGSNNPLGITSHSDKITFHPYYTIKDALGLLLFLLSLMTLTLFSPDLLGDPDNYTLANPLNTPPHIKPEWYFLFAYTILRSVPNKLGGVLALLLSILILAMIPILHMSKQQSMMFRPLSQSLYWLLAADLLILTWIGGQPVSYPFTIIGQVASVLYFTTILILMPTISLIENKMLKWA   - Human 



Mammals:
Human               -     MTPMRKTNPLMKLINHSFIDLPTPSNISAWWNFGSLLGACLILQITTGLFLAMHYSPDASTAFSSIAHITRDVNYGWIIRYLHANGASMFFICLFLHIGRGLYYGSFLYSETWNIGIILLLATMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTDLVQWIWGGYSVDSPTLTRFFTFHFILPFIIAALATLHLLFLHETGSNNPLGITSHSDKITFHPYYTIKDALGLLLFLLSLMTLTLFSPDLLGDPDNYTLANPLNTPPHIKPEWYFLFAYTILRSVPNKLGGVLALLLSILILAMIPILHMSKQQSMMFRPLSQSLYWLLAADLLILTWIGGQPVSYPFTIIGQVASVLYFTTILILMPTISLIENKMLKWA   - Human 
Chimp               -     MTPTRKINPLMKLINHSFIDLPTPSNISAWWNFGSLLGACLILQITTGLFLAMHYSPDASTAFSSIAHITRDVNYGWIIRYLHANGASMFFICLFLHIGRGLYYGSFLYLETWNIGIILLLTTMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTDLVQWVWGGYSVDSPTLTRFFTFHFILPFIITALTTLHLLFLHETGSNNPLGITSHSDKITFHPYYTIKDILGLFLFLLILMTLTLFSPGLLGDPDNYTLANPLNTPPHIKPEWYFLFAYTILRSIPNKLGGVLALLLSILILTAIPVLHTSKQQSMMFRPLSQLLYWLLATDLLILTWIGGQPVSYPFITIGQMASVLYFTTILILMPIASLIENKMLEWT   - Chimp
Cattle              -     MTNIRKSHPLMKIVNNAFIDLPAPSNISSWWNFGSLLGICLILQILTGLFLAMHYTSDTTTAFSSVTHICRDVNYGWIIRYMHANGASMFFICLYMHVGRGLYYGSYTFLETWNIGVILLLTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTNLVEWIWGGFSVDKATLTRFFAFHFILPFIIMAIAMVHLLFLHETGSNNPTGISSDVDKIPFHPYYTIKDILGALLLILALMLLVLFAPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLALAFSILILALIPLLHTSKQRSMMFRPLSQCLFWALVADLLTLTWIGGQPVEHPYITIGQLASVLYFLLILVLMPTAGTIENKLLKW    - Cattle
Bowhead Whale       -     MTNIRKTHPLMKIINDAFIDLPTPSNISSWWNFGSLLGLCLIMQILTGLFLAMHYTPDTTTAFSSITHICRDVNYGWIIRYLHANGASMFFICLYAHMGRGLYYGSHAFQETWNIGVILLFTVMATAFVGYVLPWGQMSFWGATVITNLLSAIPYVGNTLVEWIWGGFSVDKATLTRFFAFHFILPFIILALAIVHLLFLHETGSNNPTGIPSDMDKIPFHPYYTIKDILGALLLILALLMLTLFAPDLLGDPDNYTPANPLSTPAHIKPEWYFLFAYAILRSIPNKLGGVLALLLSILILAFIPMLHTSKQRSMMFRPFSQFLFWMLVADLLTLTWIGGQPVEHPYVIVGQFASILYFLLILVLMPVASLIENKLMKW    - Bowhead Whale
Killer Whale        -     MTNIRKTHPLMKILNNAFIDLPTPSNISSWWNFGSLLGLCLITQILTGLLLAMHYTPDTSTAFSSVAHICRDVNYGWFIRYLHANGASMFFICLYAHIGRGLYYGSYMFQETWNVGVLLLLAVMATAFVGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEWIWGGFSVDKATLTRFFAFHFILPFIITALTAVHLLFLHETGSNNPTGIPSNMDMIPFHPYHTIKDTLGALLLILTLLALTLFAPDLLGDPDNYTPANPLSTPAHIKPEWYFLFAYAILRSVPNKLGGVLALLLSILILIFIPMLQTSKQRSMMFRPFSQLLFWTLIADLLTLTWIGGQPVEHPYIIVGQLASILYFLLILVLMPTISLIENKLLKW    - Killer Whale
Egyptian Rousette   -     MTNIRKTHPLFKIINDSLVDLPTPSSISSWWNFGSLLGICLSIQILTGLFLAMHYTSDTATAFQSVTHICRDVNYGWVLRYLHANGASMFFICLFLHVGRGLYYGSYIFTETWNVGILLLFAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEWIWGGFSVDKATLTRFFAFHFLLPFIIAALVMVHLLFLHETGSNNPTGIPSDMDMIPFHPYHTIKDALGTLIMLLVLLTLVLFSPDLLGDPDNYIPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLALVLSILILALMPLLHTSKQRSMMFRPLSQCLFWLLVADLLTLTWIGGQPVEHPFIIIGQLASILYFSLILILMPLISIIENHLLKW    - Egyptian Rousette
European Hedgehog   -     MMNMRKTHPLMKIINNSFIDLPTPSNISSWWNFGSLLGLCLITQIITGLFLAMHYTSDTLTAFSSITHICRDVNYGWLIRYTHANGASMFFMCLFLHIGRGLYYGSYLFYETWNIGIILLIITMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTDLVQWIWGSFSVDKATLTRFFAFHFIFPFIIVAMVMIHLLFLHEAGSNNPTGITSESDKISFHPYYTLKDMLGMMFMFLILMSLVLFYPDLLGDPDNYTPANPLSTPPHIKPEWYFLFAYAILRSIPNKLGGVLALFMSILILFLLPYLHTSKHRSMVFRPVSQCIFWLLVSDLLILTWIGSQPVENPFITIGQLASIYYFLSILILIPLAGLIENYMFKW    - European Hedgehog
Giant Panda         -     MINIRKTHPLVKIINNSFIDLPTPSNISTWWNFGSLLGVCLILQILTGLFLAMHYTSDTATAFSSVAHICRDVNYGWFIRYMHANGASMFFICLFMHVGRGLYYGSYLFPETWNIGIILLLTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTNLVEWVWGGFSVDKATLTRFFAFHFILPFIISALAMVHLLFLHETGSNNPSGIPSDPDKIPFYPYHTIKDILGVLFLVLALMTLALFSPDLLGDPDNYTPANPLSAPPHIKPEWYFLFAYAILRSIPNKLGGVLALIFSILILTIIPLLHTSKQRSMMFRPLSQCLFWLLVADLLTLTWIGGQPVEHPFIIIGQLASILYFTILLVLMPITSIIENSLSKW    - Giant Panda
Numbat              -     MTNLRKTHPLMKIINHSFIDLPAPSNISAWWNFGSLLGVCLIIQILTGLFLAMHYTSDTLTAFSSVAHICRDVNYGWLIRNLHANGASMFFMCLFLHVGRGIYYGSYLYKETWNIGVILLLTVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTSLVEWIWGGFSVDKPTLTRFFALHFILPFIITALVIVHLLFLHETGSNNPSGINPNSDKIPFHPYYTIKDALGLVLMLVPLLTLALFTPDLLGDPDNFSPANQLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLALLASILVLLIIPFLHTSKQRSMMFRPVSQTLFWILAANLLTLTWIGGQPVEHPFIIIGQLASILYFTLILILMPLAGLFENYMLKPKW  - Numbat
Dunnart             -     MTNLRKTHPLMKIINHSFIDLPAPSNISAWWNFGSLLGVCLMIQILTGLFLAMHYTSDTLTAFSSVAHICRDVNYGWLIRNLHANGASMFFMCLFLHVGRGIYYGSYLYKETWNIGVVLLLTVMATAFVGYVLPWGQMSFWGATVITNLLSAIPYIGTTLAEWIWGGFSVDKATLTRFFAFHFILPFIIAALVIVHLLFLHETGSNNPSGINPDSDKIPFHPYFTIKDALGVMLLLLVLLSLALFSPDSLGDPDNFSPANPLSTPPHIKPEWYFLFAYAILRSIPNKLGGVLALLASILILLIIPFLHTANQRSMMFRPISQTLFWILTANLMTLTWIGGQPVEQPFIIIGQLASILYFMLILILMPLAGAFENYMLKPKW  - Dunnart 
Wallaroo            -     MTNLRKSHPLIKIVNHSFIDLPAPSNISAWWNFGSLLGACLIIQILTGLFLAMHYTSDTLTAFSSVAHICRDVNYGWLIRNLHANGASMFFMCLFLHVGRGIYYGSYLYKETWNIGVILLLTVMATAFVGYVLPWGQMSFWGATVITNLLSAIPYVGTTLVEWIWGGFSVDKATLTRFFAFHFILPFIITALVLVHLLFLHETGSNNPSGINPDSDKIPFHPYYTIKDALGLMLMLFILLMLALFSPDMLGDPDNFSPANPLSTPPHIKPEWYFLFAYAILRSIPNKLGGVLALLASILILLIIPLLHTSKQRSLMFRPISQTLFWILTANLITLTWIGGQPVEQPFIIIGQLASISYFLLIIILMPLAGLFENYMLEPKW  - Wallaroo
Koala               -     MTNPRKTYLLMKIINKTFIDLPTPSNISTWWNFGSLLGMCLMIQIITGLFLAMHYTPDTSTAFSSVAHICREVNYGWLIRNLHANGASVFFMCLYLHIGRGIYYGSYLYKSTWNIGVILLLMTMMTAFMGYVLPWGQMSFWGATVITNLLSAIPYIGSTLVEWIWGGFSVDKATLTQFFALHFILPFIITALTMVHLLFLHETGSNNPLGINSNPDKIPFHPYYTTKDTMGLMLLLILLTLTLLSPDTLSDPNNFSPANPLNTPQHIKPEWCFLFAYTILWSIPNKLGGVLALLASILVLFIMPFLHTSKQSSLMFRPISQTLFWILVTNLLVLTWIGSQPVEQSYTTIGQVASTTYFLLIIILMPMAGLLENFMLKPK    - Koala
Australian Echidna  -     MHNPRKTHPLIKIVNHTFIDLPTPSNISSWWNFGSLLGMCLIVQILTGLFLAMHYTADTTTAFSSVAHICRDVNYGWLIRYLHANGASLFFICIFLHVGRGLYYGSYMNTETWNIGVILLFTVMATAFVGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEWIWGGFSVDKATLTRFFAFHFILPFVVAALTIIHLLFLHETGSNNPSGLNSDSDKIPFHPYYSIKDLLGFFIATLALMLLVLFTPDLLGDPDNYTPANPLSTPPHIKPEWYFLFAYAILRSIPNKLGGVLALVASIMILALIPMLHTSRQRGLTFRPLTQTLFWILVTNLLTLTWIGGQPVEQPFILIGQLASILYFLLITVLIPFAGSLENNLLKW    - Australian Echidna

>100 million years ago:
Non-mammals:
Zebrafish           -     MTSLRKTHPVLKIANDALVDLPTPLNISAWWNFGSLLGLCLITQILTGLFLAMHYTSDISTAFSSVVHICRDVNFGWLIRSIHANGASFFFICLYIHIARGLYYGSYLYNETWNIGVVLFLLVMMTAFVGYVLPWGQMSFWGATVITNLLSAVPYVGDTLVQWIWGGFSVDNATLTRFFAFHFLLPFIIIAMVILHLLFLHETGSNNPLGLNPNMDKIPFHPYFSNKDLLGFVIMLFSLSLLALFSPNLLGDPENFTPANPLVTPPHIKPEWYFLFAYAILRSIPNKLGGVLALLFSILVLMVVPILHTSKQRGMAFRPVTQFLFWTLVADMLVLTWIGGMPVEHPYIIIGQMASILYFSLFLVLFPITGILENKALQWS              - Zebrafish
Olive Danio         -     MTSLRKTHPILKIANDALIDLPTPLNISAWWNFGSLLGLCLITQILTGLFLAMHYTSDITTAFSSVVHICRDVNYGWLIRNVHANGASFFFICLYIHIARGLYYGSYLYKETWNIGVVLFLLVMMTAFVGYVLPWGQMSFWGATVITNLLSAVPYVGDMLVQWIWGGFSVDNATLTRFFAFHFLLPFVVIAMVILHLLFLHETGSNNPLGLNPNMDKIPFHPYFSNKDLLGFVIMLFLLTLLALFSPNLLGDPENFTPANPLVTPPHIKPEWYFLFAYAILRSIPNKLGGVLALLFSILVLMVVPILHTSKQRGLAFRPATQFLFWTLVADMIVLTWIGGMPVEHPYIIIGQIASVLYFALFLILFPLMGILENKALKWA              - Olive Danio
Sea Lamprey         - MSHQPSIIRKTHPLLSLGNSMLVDLPSPANISAWWNFGSLLSLCLILQIITGLILAMHYTANTELAFSSVMHICRDVNNGWLMRNLHANGASMFFICIYAHIGRGIYYGSYLYKETWNVGVILFALTAATAFVGYVLPWGQMSFWGATVITNLISAMPYVGNDIVVWLWGGFSVSNATLTRFFTFHFILPFILAAMTMIHIMFLHQTGSSNPMGINSNLDKIQFHPYFSFKDILGFVILLGILFMISLLAPNALGEPDNFIYANPLSTPPHIKPEWYFLFAYAILRSVPNKLGGVVALAAAIMILLIIPFTHTSKQRGMQFRPLAQITFWILIADLALLTWLGGEPAEYPFILMTQIASTVYFMIFILVFPILGYLENKMLLMSKNTGKFNWKLVY  - Sea Lamprey

>500 million years ago:
Drosophila alstonvl -    MNKPLRNSHPLFKIANNALVDLPAPINISSWWNFGSLLGLCLIIQILTGLFLAMHYTADINLAFYSVNHICRDVNYGWLLRTLHANGASFFFICIYLHVGRGIYYGSYKFTPTWLIGVIILFLVMGTAFMGYVLPWGQMSFWGATVITNLLSAIPYLGMDLVQWLWGGFAVDNATLTRFFTFHFILPFIVLAMTMIHLLFLHQTGSNNPIGLNSNIDKIPFHPYFTFKDIVGFIVMIFILISLVLISPNLLGDPDNFIPANPLVTPAHIQPEWYFLFAYAILRSIPNKLGGVIALVLSIAILMILPFYNLSKFRGIQFYPINQVMFWSMLVTVILLTWIGARPVEEPYVLIGQILTVVYFLYYLVNPLITKWWDNLLN                 - Drosophila alstonvl
Drosophila brownsvl -    MNKPLRNSHPLFKIANNALVDLPAPINISSWWNFGSLLGLCLIIQILTGLFLAMHYTADINLAFYSVNHICRDVNYGWLLRTLHANGASFFFICIYLHVGRGIYYGSYKFTPTWLIGVIILFLVMGTAFMGYVLPWGQMSFWGATVITNLLSAIPYLGMDLVQWLWGGFAVDNATLTRFFTFHFILPFIVLAMTMIHLLFLHQTGSNNPIGLNSNIDKIPFHPYFTFKDIVGFIVMIFILISLVLISPNLLGDPDNFIPANPLVTPAHIQPEWYFLFTYAILRSIPNKLGGVIALVLSIAILMILPFYNLSKFRGIQFYPINQVMFWSMLVTVILLTWIGARPVEEPYVLIGQILTVVYFLYYLVNPLITKWWDNLLN                 - Drosophila brownsvl
Drosophila dahomey  -    MNKPLRNSHPLFKIANNALVDLPAPINISSWWNFGSLLGLCLIIQILTGLFLAMHYTADINLAFYSVNHICRDVNYGWLLRTLHANGASFFFICIYLHVGRGIYYGSYKFTPTWLIGVIILFLVMGTAFMGYVLPWGQMSFWGATVITNLLSAIPYLGMDLVQWLWGGFAVDNATLTRFFTFHFILPFIVLAMTMIHLLFLHQTGSNNPIGLNSNIDKIPFHPYFTFKDIVGFIVMIFILISLVLISPNLLGDPDNFIPANPLVTPAHIQPEWYFLFAYAILRSIPNKLGGVIALVLSIAILMILPFYNLSKFRGIQFYPINQVMFWSMLVTVILLTWIGARPVEEPYVLIGQILTVVYFLYYLVNPLITKWWDNLLN                 - Drosophila dahomey
Drosophila japan    -    MNKPLRNSHPLFKIANNALVDLPAPINISSWWNFGSLLGLCLIIQILTGLFLAMHYTADINLAFYSVNHICRDVNYGWLLRTLHANGASFFFICIYLHVGRGIYYGSYKFTPTWLIGVIILFLVMGTAFMGYVLPWGQMSFWGATVITNLLSAIPYLGMDLVQWLWGGFAVDNATLTRFFTFHFILPFIVLAMTMIHLLFLHQTGSNNPIGLNSNIDKIPFHPYFTFKDIVGFIVMIFILISLVLISPNLLGDPDNFIPANPLVTPAHIQPEWYFLFAYAILRSIPNKLGGVIALVLSIAILMILPFYNLSKFRGIQFYPINQVMFWSMLVTVILLTWIGARPVEEPYVLIGQILTVVYFLYYLVNPLITKWWDNLLN                 - Drosophila japan
Drosophila mysore   -    MNKPLRNSHPLFKIANNALVDLPAPINISSWWNFGSLLGLCLIIQILTGLFLAMHYTADINLAFYSVNHICRDVNYGWLLRTLHANGASFFFICIYLHVGRGIYYGSYKFTPTWLIGVIILFLVMGTAFMGYVLPWGQMSFWGATVITNLLSAIPYLGMDLVQWLWGGFAVDNATLTRFFTFHFILPFIVLAMTMIHLLFLHQTGSNNPIGLNSNIDKIPFHPYFTFKDIVGFIMMIFILISLVLISPNLLGDPDNFIPANPLVTPAHIQPEWYFLFAYAILRSIPNKLGGVIALVLSIAILMILPFYNLSKFRGIQFYPINQVMFWSMLVTVILLTWIGARPVEEPYVLIGQILTVVYFLYYLVNPLITKWWDNLLN                 - Drosophila mysore
Common Honey Bee    -   MKKFMNFFSSNEFLKMIMSTIYLPTPVNINYMWNFGSILGIFLMIQIISGFILSMHYCPNIDIAFWSITNIMKDMNSGWLFRLIHMNGASFYFLMMYIHISRNLFYCSYKLNNVWGIGIMILLMSMAAAFMGYVLPWGQMSYWGATVITNLLSAIPYIGDTIVLWIWGGFSINNATLNRFFSLHFILPLLILFMVILHLFALHLTGSSNPLGSNFNNYKISFHPYFSIKDLLGFYIILFIFMFINFQFPYHLGDPDNFKIANPMNTPTHIKPEWYFLFAYSILRAIPNKLGGVIGLVMSILILYIMIFYNNKMMNNKFNMLNKIYYWMFINNFILLTWLGKQLIEYPFTNINMLFTTTYFLYFFLNFYLSKLWDNLIWNSPLN             - Common Honey Bee
Asiatic Honey Bee   -   MKKYQNFFNSNEFLKMIMSTIYLPTPMNINYMWNFGSILGIFLMIQIVSGFILSMHYCPNIDIAFWSITNIMKDMNSGWLFRLIHMNGASFYFMMMYIHISRNMFYCSYKLSSVWGIGILILLISMAAAFMGYVLPWGQMSYWGATVITNLLSAIPYIGDTIVLWIWGGFSINNATLNRFFSLHFILPLVILFMVILHLFALHLTGSSNPLGSNYNNYKISFHPYFSIKDLLGFYIILFIFMMINFQYPYYLGDPDNFKIANPMNTPTHIKPEWYFLFAYSILRAIPNKLGGVIGLVMSILILYITILYNNKLMNNKFNLFNKIYYWMFINNFIMLTWLGKQLIEYPFIYINMFFTTTYFLYFFMSFYLSKLWENLIWKSFK              - Asiatic Honey Bee
Stingless Bee       -                                   MKFWINISMFLMIQIISGLFLSMHYCPNINLAFMSISQIMKDINSGWLIRLIHMNGASFYFLLIYIHISRNLFYYSFKLIHVWMIGSMILFLSMATAFLGYVLPWGQMSFWGAMVITNLLSALPYIGQMMVEWIWGGFSINNSTLNRFFSFHFILPFIILMMVFIHLMTLHISGSSNPIHSKSNIYKIIFHQYFSIKDLITIMMIMLIFMLINLQNPYMLSDPDNFKMANPMITPSHIKPEWYFLFAYSILRSIPNKLGGVIMLFMSIFILFLLPLMNNNKMKNIKFYPLNQFLFWMFINIFIMLTWLGGQMIEYPFTNLNNIFTILYFNYFIFSFMLNNLFDSLMKNY               - Stingless bee               
Bumble Bee          -   MKKMISMIYKTHLLNLPMSFINLPTPMNINYLWNFGSILGMFLMIQIISGLFLSMHYCPNINIAFYSISNIMKDMNSGWLIRLIHMNGASFYFLIMYFHIARNLFYYSFKLIQVWSIGVSILFLSMATAFLGYVLPWGQMSFWGAMVITNLISAIPYIGQFIVEWIWGGFSINNDTLNRFYSFHFILPFIILLMMFIHLMILHITGSSNPIHSKMNIYKINFHPYFTIKDLITMIFTFSLFMFINLQMPYMLSDPDNFKMANPMITPIHIKPEWYFLFAYSILRTIPNKLGGVIMLFMSIFILYMIPLINYNNLKNNKFYFINKFMYWWFINIFIMLTWLGSQMIEYPYTNLNMIFTLMYFMYLIMSMYMNNMWDLLLKKK               - Bumble Bee
Sapporo Bumble Bee  -   MKKMIPMIYKTHMFNLPLSFINLPTPININYMWNFGSILGMFLAIQIISGLFLSMHYCPNINIAFYSISNIMKDMNSGWLIRLIHMNGASFYFLIMYLHIARNLFYYSFKLIQVWSIGVSILFLSMATAFLGYVLPWGQMSFWGAMVITNLISAIPYIGQFTVEWIWGGFSINNDTLNRFYSFHFILPFIILLMVFIHLMILHITGSSNPIHSKMNIYKINFHPYFTIKDLITLIFTFTIFMLINLQLPFMLSDPDNFKMANPMITPIHIKPEWYFLFAYSILRTIPNKLGGVIMLFMSIFILYIIPLINYNNLKNNKFYFINKFMYWWFINIFIMLTWLGGQMIEYPYTNLNMFFTFMYFLYMIISLYMNNMWDLILKN                - Sapporo Bumble Bee
Ant                 -                 MFKTSLMSLPTPVNISFMWNYGSLLGLFLMIQIISGFFLSTHYCPNTSLAFHSIIHIMQNIKHGWLIHNIHINGASFFFICMYIHISRGIYYSSFNLKYTWLIGSSIFILSMATAFLGYVLPWGQMSFWGATVITNLISSIPYIGSLMVSWIWGGFSINNATLNRFFSLHFILPFIILFMMIMHLYMLHITGSSNPLGTNSNFNKIPFHEYFTYKDLLGYLIFMFTFFIFTFQSPYIFSDPDNFIPANPMITPTHIQPEWYFLFAYAILRSIPNKLGGVIALLMSILILFLLPMFNVQMPTPFTLSSLMNFWFFSNNFIILTWAGAQPIELPYIYISQIFSTLYFMFFMLMPLMNLFWTFIIMTNNK               - Ant
Black Fire Ant      -           MNKIMNLIKSSLLKLPTPTNISYWWNYGSLLGLFLFVQIISGFFLSIHYCPNTFYAFNSIIHIMQNISNGWLMHNIHINGATFFFICMYTHIARGMYYSSFKLIHTWMIGVTIFFISMATAFLGYVLPWGQMSFWGATVITNLVSTIPYLGTMIVEWIWGGFSINNATLNRFFSFHFILPFIILFMVIMHLFFLHETGSSNPLGTNSNLYKIPFHIYFSFKDLLGFIMYLIIFTLIILQYPYMFSDPDNFIPANPMITPIHIQPEWYFLFAYAILRSIPNKLGGVIALLASILILYTLPLQKIHMPSFSFFPLNQLLFWMFINTFILLTWAGAQPIEPPFVSVSQFLSITYFLYFIMMPLLNKIWFNLLSHNH               - Black Fire Ant
Bryozoan            -                   MKLLTHLACPSNISNFWGGGFILGFCLVLQLISGIFLSLFYSGGEITAFASTIAITRDVSGGWLVQALHANGASFFFFVIYMHIGRGIYYKSYNMFHTWMVGVTIFLALMATAFLGYVLPWGQMSFWAAQVITGLCSAVPYVGSSLTIWLWGGFSVSDATLIRFYGLHYLVPFLIAALSLAHIFFLHESWSNNPLGSAPLSPIVFQPYFTFKDMYLLLSFLAILMFVCMFSPRMFVDPENFIPANPMVTPVHIQPEWYFLPMYAILRSIPNKLGSVIGLVLSIAILYVSPLMAGEKKNTLSRKMVFWWWVSAFVGLGVIGSKTVASPFTEVGVCLSVIYFGAFFALFWQRMEDLKST                       - Bryozoan
Rhabdopleura compacta  -   MGFQDNSIVVTGFASFISDVKCPVNLSYMWAFGSILGVGLALQMVSGILLAIYFVNSSESAHSSILHIEQDVCLGWLVRSVHMNGASFLFMCLYLHAGRGIYFSIYTGHPRAWMTGMIVLVLCWASAFFGYILPWGQMSFWGATVITNLFSTVPFFGGQIVELLWGGYVISGVTLKRFYVFHFLCPIMMGLMVIAHMWFMHQTGSSQPLGRESYVDVNFHPLYTYSDIIGFCIYVSLLLWVSLFCPDMFSDPVNLVPANPFKTPNHIVPEWYFLFFYGVLRSIPSKTWGAAAAGAVMSNLFYVGSKNTNLVHSCKLRASGKKYFGVGVAVVLVSYYGASPAGMPYEDILRVIVLIIVVTLKFHNNIGSVLDTKDGYKWRAKLTTLKHDPKNCWLSDSNNYIYESSDYGGNKVTYHMDNTGHISKFHLINWWGHLSWW  -  Rhabdopleura compacta
Saccoglossus kowal. -    MIGPLRKTNPLISALNSTLVDLPSPSNLSGWWNFGSLLGLCLVSQIITGLFLAMHYTADISLAFSSIAHICRDVNYGWLLRNLHANGGSLFFICIYLHIGRGLYYGSYCNHKTWNIGVTLFLATMVTAFLGYVLPWGQMSFWGATVITNLLSAIPCLGQDLVQWVWGGFSINNATLSRFFSFHFILPFIIIVLTLLHLIFLHETGSNNPTGLNSVSDKTSFHSYYSYKDVFGFAIFIAALTSLALLFPTALLDPENFIPANPMSTPVHIQPEWYFLFAYAILRSIPNKLGGVLALLASVLILLVSPLLHLSKHQTISFLPLSQIFFWTLIANLALLTWIGGQPVEYPFIEIGQTASSIFFALFVIIIPSIHALENKLLYNSW                     - Saccoglossus kowalevskii
Acorn worm (carnosus)  - MTGPIRKNHPLISIANGALVDLPSPSNLSAWWNFGSLLGLCLITQILTGLFLAMHYTADISLAFSSVAHICRDVNYGWLLRNIHANGASFFFICIYLHIGRGLYYGSYVNQETWNIGVLLLLATMATAFFGYVLPWGQMSFWGATVITNLFSAIPYVGPDIVQWLWGGFSVSNATLTRFFTFHFVLPFIIAALSMLHLLFLHQTGSNNPTGLNSNIDKVVFHTYFSYKDVFGFIALLFGLLFIALFLPTALGDPENFVPANPLVTPVHIQPEWYFLFAYAILRSIPNKLGGVIALFASIVILFAVPILHSAHHQTIAFRPLAQVVFWALIADTLLLTWIGGQPVEDPYIILGQLSSAIYFLCFLVLIPTAGILENRLNLNPL                     - Acorn worm
Acorn worm (clavigerus)- MTGPIRKNHPLISIANGALVDLPSPSNLSAWWNFGSLLGLCLIVQVLTGLFLAMHYTADISLAFSSVSHISRDVNYGWLLRNIHANGASLFFICIYLHIGRGLYYGSYVNQETWNIGVILLLATMATAFFGYVLPWGQMSFWGATVITNLFSAIPYLGTDIVQWLWGGFSVSNATLTRFFTFHFVLPFVIMALSMLHLLFLHQTGSNNPTGLNSNVDKVVFHTYFSYKDVFGFAILVFALLVIALFFPTALGDPENYVPANPLVTPVHIQPEWYFLFAYAILRSIPNKLGGVVALAASIVVLFAVPILHSAHHQTIAFRPLTQAVFWILIANTLLLTWLGGQPVEDPYIILGQLSSAVYFLCFLAFIPMAGLLENRLNLTPLCFCSWTTTTAFQTASLG    - Acorn worm
Ribbon worm (rufifrons)- MFSPFRKVHPALSIVNSALVDYPTPSNISNWWNFGFLLGACLGLQLVTGIFLAMHYVGHVDLAFSSVSHIVRDVNYGWLLRTMHANGASFFFFCLYFHVGRGIYYGSYFFVEAWNIGVVLLLLVMATAFLGYVLPWGQMSFWGATVITNLLSAVPYVGNMLVQWIWGGFAVDNATLTRFFAFHFLFPFIITGMAILHLLFLHETCSNNPLGLNSDSDKIPFHSYFVVKDLFGVILMFFLLISLVLFSPNLLGDPENFIPANPLVTPVHIQPEWYFLFAYAVLRSVPNKLGGVLGLLFSILILFFLPFLHGGKFRVFSFYFLNQIFFWFFVIIFLILTWIGARPVESPYEGIGQIFSILYFFYFLSFPFLQLFWDEILDY                        - Ribbon worm
Ribbon worm (simula)   - MFLPLRKVHPVMTILNSSLIGYPTPSNISNWWNFGFLLGACLGLQLITGIFLAMHYVGHVDLAFSSISHIVRDVNYGWLLRTLHANGASFFFFCLYFHVGRGIYYGSYFFSETWNIGVVLLLLIMATAFLGYVLPWGQMSFWGATVITNLLSAFPYIGNMLVQWIRGGFAVDNATLTRFFAFHFLFPFIITGLVILHLLFLHETCSNNPLGLNSDSDKIPFHLYFVVKDFFAVIMMFFLLISLVLMSPNLLGDPENFIPVNPLVTPVHIQPEWYFLFAYAILRSVPNKLGGVMGLLMSILILFFIPFLHVGKFKVFSFYFLNQIFFWFFVVIFLILTWIGARPVESPYEGIGQIFSVFYFFYFLSFPFMQKGWDNILDY                        - Ribbon worm
Leech                  - MMMQLRKSHPVMKVLNGAMVDLPAPLNISIWWNYGSLLGLMLIIQLITGLLLSMHYCSNVELAFSSVVHIMRNVDFGWMLRYTHANAASLFFLFMYIHIGRGIYYMSFVLIEVWNIGVVLFILTVATAFLGYVLPWGQMSFWGATVITNLLSTIPYSGTSIVEWVWGGFSISNPTLTRFFSIHFVLPFVMVAFVIIHLLFLHQTGSNNPLGVVSDSDRITFHPYYLIKDLLGFLLAFLLLLMLVFFMPNLFSDSENFMPANPSMTPTHIKPEWYFLWIYAILRSIPNKLGGVIAAFSGILIMFVLPLYNFSQIKSLMFYPLNSLLFFYLLFFPFIILTWIGGCPVKDLYINVGQVCTVMYFSYFLFTPFLFKMFDVLMVKD                      - Leech

Comparative phylogeny:

NC_012920 Homo sapiens              Human              Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo
NC_001643 Pan troglodytes           Chimp              Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Pan
NC_006853 Bos taurus                Cattle             Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia; Pecora; Bovidae; Bovinae; Bos
NC_005268 Balaena mysticetus        Bowhead Whale      Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Cetacea; Mysticeti; Balaenidae; Balaena
NC_014682 Orcinus orca              Killer Whale       Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Cetacea; Odontoceti; Delphinidae; Orcinus
NC_007393 Rousettus aegyptiacus     Egyptian Rousette  Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Chiroptera; Megachiroptera; Pteropodidae; Pteropodinae; Rousettus
NC_002080 Erinaceus europaeus       European Hedgehog  Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Insectivora; Erinaceidae; Erinaceinae; Erinaceus
NC_009492 Ailuropoda melanoleuca    Giant Panda        Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Ursidae; Ailuropoda
FJ515782  Myrmecobius fasciatus     Numbat             Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Metatheria; Dasyuromorphia; Myrmecobiidae; Myrmecobius
AY795974  Sminthopsis crassicaudata Dunnart            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Metatheria; Dasyuromorphia; Dasyuridae; Sminthopsis
NC_001794 Macropus robustus         Wallaroo           Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Metatheria; Diprotodontia; Macropodidae; Macropus
NC_008133 Phascolarctos cinereus    Koala              Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Metatheria; Diprotodontia; Phascolarctidae; Phascolarctos
NC_003321 Tachyglossus aculeatus    Australian Echidna Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Monotremata; Tachyglossidae; Tachyglossus
NC_002333 Danio rerio               Zebrafish          Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Cyprinidae; Danio
AP011235  Danio dangila             Olive Danio        Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Cyprinidae; Danio
NC_014764 Protopterus aethiopicus   Marbled Lungfish   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Dipnoi; Lepidosireniformes; Protopteridae; Protopterus
NC_009736 Egretta eulophotes        Chinese Egret      Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Ciconiiformes; Ardeidae; Egretta
NC_006403 Hyla chinensis            Chinese Toad       Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Neobatrachia; Hyloidea; Hylidae; Hylinae; Hylini; Hyla
NC_001626 Petromyzon marinus        Sea Lamprey        Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Hyperoartia; Petromyzontiformes; Petromyzontidae; Petromyzon
NC_004447 Ciona intestinalis        Sea squirt         Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Enterogona; Phlebobranchia; Cionidae; Ciona
NC_001912 Branchiostoma lanceolatum Amphioxus          Eukaryota; Metazoa; Chordata; Cephalochordata; Branchiostomidae; Branchiostoma. 
NC_012616 Apostichopus japonicus    Jap. Sea Cucumber  Eukaryota; Metazoa; Echinodermata; Eleutherozoa; Echinozoa; Holothuroidea; Aspidochirotacea; Aspidochirotida; Stichopodidae; Apostichopus
NC_002546 Fasciola hepatica         Liver Fluke        Eukaryota; Metazoa; Platyhelminthes; Trematoda; Digenea; Echinostomida; Echinostomata; Echinostomatoidea; Fasciolidae; Fasciola
NC_010220 Biomphalaria tenagophila  Snail              Eukaryota; Metazoa; Mollusca; Gastropoda; Pulmonata; Basommatophora; Lymnaeoidea; Planorbidae; Biomphalaria
NC_001709 Drosophila melanogaster   Fruit Fly          Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora
NC_001566 Apis mellifera ligustica  Honey Bee          Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Hymenoptera; Apocrita; Aculeata; Apoidea; Apidae; Apis
AF466146  Melipon abicolor          Stingless Bee      Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Hymenoptera; Apocrita; Aculeata; Apoidea; Apidae; Melipona
DQ870926  Bombus ignitus            Bumble bee         Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Hymenoptera; Apocrita; Aculeata; Apoidea; Apidae; Bombus; Bombus
AB556947  Pristomyrmex punctatus    Ant                Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Hymenoptera; Apocrita; Aculeata; Vespoidea; Formicidae; Myrmicinae; Pristomyrmex
HQ215539  Solenopsis richteri       Black fire ant     Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Hymenoptera; Apocrita; Aculeata; Vespoidea; Formicidae; Myrmicinae; Solenopsis
NC_014587 Hipparchia autonoe        Russian Grayling   Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Papilionoidea; Nymphalidae; Satyrinae; Satyrini; Satyrina; Hipparchia
NC_008192 Flustrellidra hispida     Bryozoan           Eukaryota; Metazoa; Bryozoa; Gymnolaemata; Ctenostomata; Flustrellidridae; Flustrellidra
FN908482  Rhabdopleura compacta                        Eukaryota; Metazoa; Hemichordata; Pterobranchia; Rhabdopleurida; Rhabdopleuridae; Rhabdopleura
AY336131  Saccoglossus kowalevskii                     Eukaryota; Metazoa; Hemichordata; Enteropneusta; Harrimaniidae; Saccoglossus
AF051097  Balanoglossus carnosus    Acorn worm         Eukaryota; Metazoa; Hemichordata; Enteropneusta; Ptychoderidae; Balanoglossus
FN562579  Balanoglossus clavigerus  Acorn Worm         Eukaryota; Metazoa; Hemichordata; Enteropneusta; Ptychoderidae; Balanoglossus
EF140788  Cephalothrix rufifrons    Ribbon worm        Eukaryota; Metazoa; Nemertea; Anopla; Paleonemertea; Cephalothricidae; Cephalothrix
FJ594739  Cephalothrix simula       Ribbon worm        Eukaryota; Metazoa; Nemertea; Anopla; Paleonemertea; Cephalothricidae; Cephalothrix
EU304459  Whitmania pigra           Leech              Eukaryota; Metazoa; Annelida; Clitellata; Hirudinida; Hirudinea; Arhynchobdellida; Hirudiniformes; Haemopidae; Whitmania.