Examples of Comparative Biology

Diagrams for the peptide ATP8 from several species are shown here.
It is unclear for the present as to whether these diagrams should be identical to each other.

Examples of non-synonymous mutations are:
C8414T - 'L17F' (defines Haplogroup D4 etc.)
T8448C - 'M28T' (defines H11 etc.)
A8460G - 'N32S' (defines Haplogroup L0a2 etc.)
A8502G - 'N46S' (defines Haplogroup M2 etc.)

ATP8  Mammal - Human NC_012920
Enlarge

Chimp  Mammal - Chimp - NC_001643
Enlarge

Chinese Toad  Amphibian - Chinese Tree Toad - NC_006403
Enlarge

Brown Hydra  Amphibian - Brown Hydra - NC_010214
Enlarge

Amino acid sequences for peptide ATP8:-

(Last 15 codons are non-functioning as ATP6 starts at 8527                    xxxxxxxxxxxxxxx)
(Possibly the 'GAA', an 'E' could have been 'TAA' in the past.  However G8519T has not been observed) 
                              1         2         3         4         5
Mammals:
Human                - MPQLNTTVWPTMITPMLLTLFLITQLKMLNTNYHLPPSPKPMKMKNYNK    PW EPKWTKICSLHSLPPQS  - Human       (ends at TAG - 8570 CRS)
NUMT Chrs1:554327    - MPQLNTTVWPTMITPMLLTLFLITQLKMLNTNYHLPPSPKPMKMKNYNK    PW EPKWTKICSLHSLPPQS
'Neanderthal'        - MPQLNTTVWPTMIIPMLLTLFLITQLKMLNTNYHLPPSPKPMKMKNYNK    PW EPKWTKICSLHSLPPQS  - 'Neanderthal' (AM948965)
'Altai'              - MPQLNTTVWPTMIIPMLLTLFLITQLKMLNTNYHLPPSPKPMKMKNYNK    PW EPKWTKICSLHSLPPQS  - 'Altai' (FN673705)
Chimp                - MPQLNTAVWPTMITPMLLTLFLVTQLKMLNSNYHLPPSPKPMKMKNYNK    PW EPKWTKIYSLHSLPPQS  - Chimp       (ends at TAG - 7988)
Gibbon               - MPQLNTTVWPTIIMSMLLALFLLMQLKTLNTHYHPPASPKLTNIKPHNN    PW EHKWTKIYSLHSLPPQF  - Gibbon
Gorilla              - MPQLNTTVWPTMIAPMLLTLFLITQLKVLNTNYHLPPLPKTMKMKNFCK    PW EPKWTKIYSLHSLPPQS  - Gorilla
Baboon               - MPQLDTSTWFTIIMAMLPTLYLITQLKLLSMNYYQPPLTKNPNLQTHNT    CW RPKWTKTYLPHSQPQQS  - Baboon
Dusky Leaf Monkey    - MPQLNTSTWFITIMTMLPALYLIMQLKLLNTNYYLPPTQKTPNTQMFNN    SW QLKWTKIYLPHLQPQHS  - Dusky Leaf Monkey
Slow Loris           - MPQLDTSTWTITIMSMILTLFILFQLKLSKFMYPTNPTKKLTKPHKLES    PW EMKWTKTYLPHSLPLQ   - Slow Loris
Tree Shrew           - MPQLDTSTWFITIVSMLATLFILFQLKLSSYCYYNLPQTKTMKTKKQDT    PW NQKWTKTYLPLSLPRH   - Northern Tree Shrew
Cattle               - MPQLDTSTWLTMILSMFLTLFIIFQLKVSKHNFYHNPELTPTKMLKQNT    PW ETKWTKIYLPLLLPL    - Cattle      (ends at TAG - 8333)
Hippopotamus         - MPQLDTSTWFTTILSMFLTLFIIFQLKISKHTYHPNPETTLPMTQKQPT    PW ETKWTKIYSPLSLPLQS  - Hippopotamus
Bowhead Whale        - MPQLDTSTWLLTILSMLLTLFVLLQLKISKHSHSPNPKLVLTKTRKQQT    PW NTTWTKIYLPLS       - Bowhead Whale
Blue Whale -         - MPQLDTSTWLLTILSMLLTLFVLFQLKISKHSYSPNPKLVPTKTQKQQT    PW NITWTKIYLPLL       - Blue Whale
Killer Whale         - MPQLDTSTWPLTILSMIFTLFALLQLKISKHFYSPSPKPADTKLQKQQT    PW NCMWTKIYLPLS       - Killer Whale
Egyptian Rousette    - MPQLDTSTWFITIVSMLLTLYIIMQLKVSKNVYHQNPEPTITKSTKHPT    PW EDKWTKIYSPLSLPLR   - Egyptian Rousette Bat
European Hedgehog    - MPQLDTSSWFTMILAMFLTLFIIMQLKINSYKTYNMMETKKQTLNHSLK    PW EHKWTKIYLPLLLPLHY  - European Hedgehog
Moonrat              - MPQLDTSTWFSTIIVMIMTLFILFQLKFSTYNYISSPEIKLINLTTHKN    SW ETKWTKIYLPLL       - Moonrat
Giant Panda          - MPQLDTSTWFITILSMILTLFIMFQLKVSKHNYPEFPELKTTPLSKKPM    PW EEKWTKICSPLLLPQW   - Giant Panda
Spectacled Bear      - MPQLDTSTWFITILSMTLTLFIVFQLKILEYNYPKTPELKPFPPSKKTM    PW EKKWTKIYLPLLLPQR   - Spectacled Bear
Cape Golden Mole     - MPQLDTNTWFITIISATLTLFILFQINFSKLTFYLEPEPKLLKSTEHKN    PW ETKWTKIYLPHSSLPH   - Cape Golden Mole
9-band Armadillo     - MPQLDTSTWFITIVSMLLSLFILMQLKFIKFSSFSTPCPTTMEKTKHLT    PW EMKWTKTYLPHSLPLP   - 9-band Armadillo
Wallaroo             - MPQLDTSTWLLTITLMILALFCIYQSKMINQTMISIPPQDKKVIKPTTQL   PW ESKWTKIYLPHSSPLLS  - Wallaroo    (ends at TAG)
Koala                - MPQLNMSMWPLTITLTMLTFFCMYQLKMINQTMTSMTPKNEKKMPTKTQL   PW NKKWTKIYLPNSLPPQL  - Koala
Australian Echidna   - MPQLDTSTWFMAILLMVFTIYGIFQLKVVKYLPTVLPTPSTQAMPVTNLT   PW NSKWTKIYLPHSSLLQS  - Australian Echidna

> 100 million years
Non-mammals:
Zebrafish            - MPQLNPKPWFMILFFSWVIFLTIIPTKIINHIQPNDPTQVDAKEHKNDTW   NW PW                 - Zebrafish          (ends with TAA)
Marbled Lungfish     - MPQLNPGPWLIILLISWLTLLLILLPKILSHKNSNPPTPQNQDKLFLAPWNW PW L                  - Marbled Lungfish
Chinese Egret        - MPQLNPNPWFFILLMSWSVFSLIIQPKLLSFTTTNPPSTKPKVTPKTTPWAW PW T                  - Chinese Egret      (ends with TAA)
Chinese Tree Toad    - MPQLDPMPWFSILFASWLIFLVFSPTKVAKYSSLNDPSPKTYKGLNKSWPW  PW A                  - Chinese Tree Toad  (ends with TAA)
Afr. Clawed Frog     - MPQLNPGPWFLILIFSWLVLLTFIPPKVLKHKAFNEPTTQTTEKSKPNPWNW PW T                  - African Clawed Frog 
Sea Lamprey          - MPQLDPAPWFSMLTVSWLIIFLLIMPTILFYQPQNTISTKQVTKPKQSTWTW PW H                  - Sea Lamprey        (ends with TAA) 
Atlantic Hagfish     - MPQLNPSPWLLMALSLWVCFPLMMLSLSSFLPLTLKTSLPSTLKSSPNPWIL PW                    - Atlantic Hagfish
Sea Squirt           - MPQLNLFSFFYISVVSFSLLMTSFSYEPILVPVSR                                        - Sea Squirt
Amphioxus            - MPQLNPIPWVFLFFLVWLVLGFLGLQKFTSVVTTTLDDSSEEVEVKSKEYSW PW                    - Amphioxus
Brown Hydra          - MSQLDLSLYFNHYFVLLLLFLILIILLSIKFYNFFLVLNIRNNISCSSLKLNIINPKQFSILQSILKS       - Brown Hydra
Jap. Sea Cucumber    - MPQLDLSWFIINFFLAWSLVIVMIVVLVKQNWLSDKEGDSQHNNKIEQQQN  EW NW                 - Jap. Sea Cucumber
Liver Fluke          - ----                                                                       - Liver fluke
Snail                - MPQLSPTSGIMIFFMVITTCFLLYILFSMKENSPVYFLWQTDAKILSVF                          - Snail
Honey Bee            - MPQMMPMKWFLIYFIYLLIFYLFIMLINSMLIKTKINKETLKIKLKKWNW   FW                    - Honey Bee
Russian Grayling     - MPQMMPINWLLSLLFFICIFILFNIINYYIFNYNYNSKNMSKTLTFKNNL   PW KW                 - Russian Grayling
Drosophila Alstonvl  - MPQMAPISWLLLFIIFSITFILFCSINYYSYMPNSPKSNELKNINLNSM    NW KW                 - Drosophila Alstonvl
Drosophila Brownsvl  - MPQMAPISWLLLFIIFSITFILFCSINYYSYMPNSPKSNELKNINLNSM    NW KW                 - Drosophila Brownsvl
Drosophila Dahomey   - MPQMAPISWLLLFIIFSITFILFCSINYYSYMPNSPKSNELKNINLNSM    NW KW                 - Drosophila Dahomey
Drosophila Japan     - MPQMAPISWLLLFIIFSITFILFCSINYYSYMPNSPKSNELKNINLNSM    NW KW                 - Drosophila Japan 
Drosophila Mysore    - MPQMAPISWLLLFIIFSITFILFCSINYYSYMPNSPKSNELKNINLNSM    NW KW                 - Drosophila Mysore
Drosophila Zimbabwe  - MPQMAPISWLLLFIIFSITFILFCSINYYSYMPNSPKSNELKNINLNSM    NW KW                 - Drosophila Zimbabwe
Drosophila NC_001709 - MPQMAPISWLLLFIIFSITFILFCSINYYSYMPNSPKSNELKNINLNSM    NW KW                 - Drosophila NC_001709
Drosophila grimshawi - MPQMAPISWLLLFFLFSMIFILFCSINYYAYMPSSPKSNELKSMNLNSM    NW KW                 - Drosophila grimshawi
Drosophila sechellia - MPQMAPISWLLLFIIFSITFILFCSINYYSYTPNSPKSNELKNINLNSM    NW KW                 - Drosophila sechellia
Drosophila simulans  - MPQMAPISWLLLFIIFSITFILFCSMNYYSYIPNSPKSNELKNINLNSM    NW KW                 - Drosophila simulans
Drosophila virilis   - MPQMAPIKWLTLFFIFSITFILFCSMNYYAYMPSSPKSNELKNINLNSM    NW KW                 - Drosophila virilis
Drosophila mojavensis- MPQMAPISWLLLFFIFSITFILFCSLNYYSYLPSSPKSNELKNIKLNSM    NW KW                 - Drosophila mojavensis
Drosophila littoralis- MPQMAPIKWLTLFFIFSITFILFCSVNYYAYMPSSPKSNELKNINLNSM    NW KW                 - Drosophila littoralis
Drosophila pseudoobs.- MPQMAPISWLLLFIVFSITFILFCSINYYSFMPSSPKSNELKNINLNSM    NW KW                 - Drosophila pseudoobscura
Drosophila erecta    - MPQMAPISWLLLFIIFSIVFILFCATNYYSYMPTSPKSNELKNINLNSM    NW KW                 - Drosophila erecta
Celery leafminer     - MPQMAPISWLTLFLIFFLTFIMFNIMNYFSYFPSSPSHQKKLFTVKSM     NW KW                 - Celery leafminer
Hangingfly           - MPQMAPISWLTLFILFSLIFIIFNIVNYYNYSPNTPSYSLESKILTSPL    NW KW                 - Hangingfly
Snow scorpiion fly   - MPQMAPINWLSLFLLFSIIFLIYNYMNYYMYMPMYSLKSMNKSFLFKSL    NW KW                 - Snow scorpion fly
Scorpion fly         - MPQMAPISWLSLFIMFSIIFMMFNIMIYFLSQPNVPLSTKSNMINTPSL    NW KW                 - Scorpion fly
Bryozoan             - MPHLSPLSWFMYFTCLNCVILLVIISAEMK                                             - Bryozoan
Rhabdopleura compact.- MGSVYFSLVGTLGVFCFFVKCSFYSTIFFLDVFSWCFSPVSLVSGLNPWIGVCAYFCLLSFKIYIPGLFYYFWMLVLFFFF
Saccoglossus kowal.  - MPQLAPNFWALNFIMIWTLLITITTLTISLPPSNLPSAESRRPLTPTHP    NW PWHL
Acorn worn(carnosus) - MPQLNPDFWALNFVTVWLLLAIALATTTSLQLPLQPSPSSLQHHTLSTP    QW LWT
Acorn worm(clavigerus) MPQLNPDFWALNFITVWLLVAIALATTASLQLPLPPSSSAPHPHHTFSTP   QW LWT

Comparative phylogeny:

NC_012920 Homo sapiens              Human              Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo
NC_001643 Pan troglodytes           Chimp              Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Pan
NC_006853 Bos taurus                Cattle             Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia; Pecora; Bovidae; Bovinae; Bos
NC_000889 Hippopotamus amphibius    Hippopotamus       Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Hippopotamidae; Hippopotamus
NC_005268 Balaena mysticetus        Bowhead Whale      Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Cetacea; Mysticeti; Balaenidae; Balaena
NC_001601 Balaenoptera musculus     Blue whale         Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Cetacea; Mysticeti; Balaenopteridae; Balaenoptera
NC_014682 Orcinus orca              Killer Whale       Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Cetacea; Odontoceti; Delphinidae; Orcinus
NC_007393 Rousettus aegyptiacus     Egyptian Rousette  Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Chiroptera; Megachiroptera; Pteropodidae; Pteropodinae; Rousettus
NC_002080 Erinaceus europaeus       European Hedgehog  Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Insectivora; Erinaceidae; Erinaceinae; Erinaceus
NC_002808 Echinosorex gymnura       Moonrat            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Insectivora; Erinaceidae; Galericinae; Echinosorex
NC_009492 Ailuropoda melanoleuca    Giant Panda        Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Ursidae; Ailuropoda
NC_009969 Tremarctos ornatus        Spectacled Bear    Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Carnivora; Caniformia; Ursidae; Tremarctos
NC_004920 Chrysochloris asiatica    Cape Golden Mole   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Afrotheria; Chrysochloridae; Chrysochlorinae; Chrysochloris
NC_001821 Dasypus novemcinctus      9-band armadillo   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Xenarthra; Dasypodidae; Dasypus
NC_001794 Macropus robustus         Wallaroo           Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Metatheria; Diprotodontia; Macropodidae; Macropus
NC_008133 Phascolarctos cinereus    Koala              Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Metatheria; Diprotodontia; Phascolarctidae; Phascolarctos
NC_003321 Tachyglossus aculeatus    Australian Echidna Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Monotremata; Tachyglossidae; Tachyglossus
NC_002333 Danio rerio               Zebrafish          Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Cypriniformes; Cyprinidae; Danio
NC_014764 Protopterus aethiopicus   Marbled Lungfish   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Dipnoi; Lepidosireniformes; Protopteridae; Protopterus
NC_009736 Egretta eulophotes        Chinese Egret      Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Ciconiiformes; Ardeidae; Egretta
NC_006403 Hyla chinensis            Chinese Toad       Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Neobatrachia; Hyloidea; Hylidae; Hylinae; Hylini; Hyla
NC_001573 Xenopus laevis            Afr. clawed frog   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae; Xenopodinae; Xenopus; Xenopus
NC_001626 Petromyzon marinus        Sea Lamprey        Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Hyperoartia; Petromyzontiformes; Petromyzontidae; Petromyzon
NC_002639 Myxine glutinosa          Atlantic Hagfish   Eukaryota; Metazoa; Chordata; Craniata; Hyperotreti; Myxiniformes; Myxinidae; Myxininae; Myxine
NC_004447 Ciona intestinalis        Sea squirt         Eukaryota; Metazoa; Chordata; Tunicata; Ascidiacea; Enterogona; Phlebobranchia; Cionidae; Ciona
NC_001912 Branchiostoma lanceolatum Amphioxus          Eukaryota; Metazoa; Chordata; Cephalochordata; Branchiostomidae; Branchiostoma. 
NC_010214 Hydra oligactis           Brown Hydra        Eukaryota; Metazoa; Cnidaria; Hydrozoa; Hydroida; Anthomedusae; Hydridae; Hydra.
NC_012616 Apostichopus japonicus    Jap. Sea Cucumber  Eukaryota; Metazoa; Echinodermata; Eleutherozoa; Echinozoa; Holothuroidea; Aspidochirotacea; Aspidochirotida; Stichopodidae; Apostichopus
NC_002546 Fasciola hepatica         Liver Fluke        Eukaryota; Metazoa; Platyhelminthes; Trematoda; Digenea; Echinostomida; Echinostomata; Echinostomatoidea; Fasciolidae; Fasciola
NC_002544 Schistosoma japonicum     Oriental Fluke     Eukaryota; Metazoa; Platyhelminthes; Trematoda; Digenea; Strigeidida; Schistosomatoidea; Schistosomatidae; Schistosoma
NC_010220 Biomphalaria tenagophila  Snail              Eukaryota; Metazoa; Mollusca; Gastropoda; Pulmonata; Basommatophora; Lymnaeoidea; Planorbidae; Biomphalaria
NC_001566 Apis mellifera ligustica  Honey Bee          Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Hymenoptera; Apocrita; Aculeata; Apoidea; Apidae; Apis
NC_001709 Drosophila melanogaster   Fruit fly          Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora
GU327644  Liriomyza trifolii        Celery leafminer   Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Opomyzoidea; Agromyzidae; Phytomyzinae; Liriomyza.
HQ696578  Bittacus pilicornis       Hangingfly         Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Mecoptera; Bittacidae; Bittacus.
NC_014587 Hipparchia autonoe        Russian Grayling   Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Lepidoptera; Glossata; Ditrysia; Papilionoidea; Nymphalidae; Satyrinae; Satyrini; Satyrina; Hipparchia
NC_008192 Flustrellidra hispida     Bryozoan           Eukaryota; Metazoa; Bryozoa; Gymnolaemata; Ctenostomata; Flustrellidridae; Flustrellidra
FN908482  Rhabdopleura compacta                        Eukaryota; Metazoa; Hemichordata; Pterobranchia; Rhabdopleurida; Rhabdopleuridae; Rhabdopleura
AY336131  Saccoglossus kowalevskii                     Eukaryota; Metazoa; Hemichordata; Enteropneusta; Harrimaniidae; Saccoglossus
AF051097  Balanoglossus carnosus    Acorn worm         Eukaryota; Metazoa; Hemichordata; Enteropneusta; Ptychoderidae; Balanoglossus
FN562579  Balanoglossus clavigerus  Acorn Worm         Eukaryota; Metazoa; Hemichordata; Enteropneusta; Ptychoderidae; Balanoglossus